catalog number :
MBS951872
products type :
Recombinant Protein
products full name :
Recombinant Mouse Fas apoptotic inhibitory molecule 3
products short name :
Fas apoptotic inhibitory molecule 3
products name syn :
Regulator of Fas-induced apoptosis Toso
other names :
fas apoptotic inhibitory molecule 3; Fas apoptotic inhibitory molecule 3; fas apoptotic inhibitory molecule 3; Fc fragment of IgM receptor; IgM Fc fragment receptor
products gene name :
Faim3
other gene names :
Fcmr; Fcmr; Toso; Faim3; FcmuR; 1810037B05Rik
uniprot entry name :
FAIM3_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
18-262
sequence :
RVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPG
ICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTE
NDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEW
TSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAP
KTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPA
TTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGR
EDRGLHIPIPE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Ses to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation.
products references :
Song Y., Jacob C.O.
ncbi acc num :
NP_081252.1
ncbi gb acc num :
NM_026976.2
uniprot summary :
FAIM3: May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Apoptosis. Cellular Component: cell surface; external side of plasma membrane; integral to membrane; membrane. Molecular Function: protein binding. Biological Process: immune system process
size4 :
0.05 mg (Baculovirus)