Recombinant Human Protein Wnt-3a (WNT3A), partial | MyBioSource MBS951831 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Protein Wnt-3a (WNT3A), partial

catalog :

MBS951831

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS951831

products type :

Recombinant Protein

products full name :

Recombinant Human Protein Wnt-3a (WNT3A), partial

products short name :

Protein Wnt-3a (WNT3A), partial

products name syn :

Protein Wnt-3a

other names :

protein Wnt-3a; Protein Wnt-3a; protein Wnt-3a; wingless-type MMTV integration site family, member 3A

products gene name :

WNT3A

other gene names :

WNT3A; WNT3A

uniprot entry name :

WNT3A_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

19-352, Mature full length protein

sequence length :

352

sequence :

SYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCR
NYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLA
IFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAI
CGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARE
NRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCE
VKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGW
VETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFG
TRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCV
FHWCCYVSCQECTRVYDVHTCK

purity :

>90%

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

other info1 :

Species: Homo sapiens (Human)

products description :

Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.

ncbi gi num :

14916475

ncbi acc num :

NP_149122.1

ncbi gb acc num :

NM_033131.3

uniprot acc num :

P56704

ncbi mol weight :

41kD

ncbi pathways :

Basal Cell Carcinoma Pathway (83113); Basal Cell Carcinoma Pathway (525); Canonical Wnt Signaling Pathway (138032); Cardiac Progenitor Differentiation Pathway (712094); Class B/2 (Secretin Family Receptors) Pathway (106378); DNA Damage Response (only ATM Dependent) Pathway (198827); GPCR Ligand Binding Pathway (161020); HTLV-I Infection Pathway (373901); HTLV-I Infection Pathway (373889); Hedgehog Signaling Pathway (83063)

ncbi summary :

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. This gene is clustered with WNT14 gene, another family member, in chromosome 1q42 region. [provided by RefSeq, Jul 2008]

uniprot summary :

WNT3A: Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube. Interacts with PORCN. Interacts with APCDD1 and WLS. Component of the Wnt-Fzd-LRP5-LRP6 signaling complex that contains a WNT protein, a FZD protein and LRP5 or LRP6. Interacts directly in the complex with LRP6. Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate. Belongs to the Wnt family. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 1q42. Cellular Component: proteinaceous extracellular matrix; extracellular space; cell surface; endoplasmic reticulum lumen; early endosome membrane; Golgi lumen; plasma membrane; extracellular region. Molecular Function: protein domain specific binding; protein binding; frizzled binding; transcription coactivator activity; receptor agonist activity; frizzled-2 binding. Biological Process: positive regulation of mesodermal cell fate specification; axon guidance; extracellular matrix organization and biogenesis; positive regulation of protein binding; cell proliferation in forebrain; positive regulation of transcription, DNA-dependent; positive regulation of receptor internalization; positive regulation of caspase activity; Wnt receptor signaling pathway through beta-catenin; palate development; positive regulation of collateral sprouting in the absence of injury; negative regulation of axon extension involved in axon guidance; negative regulation of neurogenesis; Wnt receptor signaling pathway in forebrain neuroblast division; neuron differentiation; mammary gland development; positive regulation of cell proliferation; positive regulation of B cell proliferation; hemopoiesis; heart looping; dorsoventral neural tube patterning; inner ear morphogenesis; in utero embryonic development; hippocampus development; negative regulation of fat cell differentiation; positive regulation of peptidyl-serine phosphorylation; osteoblast differentiation; paraxial mesodermal cell fate commitment; signalosome assembly; spinal cord association neuron differentiation; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

490

size3 :

0.5 mg (E-Coli)

price3 :

715

size4 :

0.05 mg (Baculovirus)

price4 :

950

size5 :

1 mg (E-Coli)

price5 :

1170

more info or order :

MyBioSource product webpage