protein

Recombinant Human Melanoma antigen preferentially expressed in tumors

MBS951713

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Melanoma antigen preferentially expressed in tumors

Melanoma antigen preferentially expressed in tumors

Opa-interacting protein 4; OIP-4; Preferentially expressed antigen of melanoma

melanoma antigen preferentially expressed in tumors isoform a; Melanoma antigen preferentially expressed in tumors; melanoma antigen preferentially expressed in tumors; preferentially expressed antigen in melanoma; Opa-interacting protein 4; OIP-4; Preferentially expressed antigen of melanoma

PRAME

PRAME; PRAME; MAPE; OIP4; CT130; OIP-4; MAPE; OIP4; OIP-4

PRAME_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-509

509

MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEA
LAIAALELLPRELFPPLFMAAFDGRHSQTLKAMVQAWPF
TCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRW
KLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMT
KKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYL
IEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDS
IEDLEVTCTWKLPTLAKFSPY

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Apoptosis

Functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. Prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.

Characterization of an antigen that is recognized on a melanoma showing partial HLA loss by CTL expressing an NK inhibitory receptor.Ikeda H., Lethe B.G., Lehmann F., van Baren N., Baurain J.-F., de Smet C., Chambost H., Vitale M., Moretta A., Boon T., Coulie P.G.Immunity 6:199-208(1997) A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11(2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

619328985

NP_001278644.1

NM_001291715.1

P78395

62kD

This gene encodes an antigen that is preferentially expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. The encoded protein acts as a repressor of retinoic acid receptor, and likely confers a growth advantage to cancer cells via this function. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]

PRAME: Functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. Prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis. Belongs to the PRAME family. Protein type: Cancer Testis Antigen (CTA); Nuclear receptor co-regulator; Transcription, coactivator/corepressor. Chromosomal Location of Human Ortholog: 22q11.22. Cellular Component: nucleus; plasma membrane. Molecular Function: protein binding; retinoic acid receptor binding. Biological Process: apoptosis; cell differentiation; negative regulation of apoptosis; negative regulation of cell differentiation; negative regulation of retinoic acid receptor signaling pathway; negative regulation of transcription, DNA-dependent; positive regulation of cell proliferation; regulation of growth; transcription, DNA-dependent

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750