protein

Recombinant Mouse Dual specificity mitogen-activated protein kinase kinase 4

MBS951626

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Mouse Dual specificity mitogen-activated protein kinase kinase 4

Dual specificity mitogen-activated protein kinase kinase 4

C-JUN N-terminal kinase kinase 1; JNK kinase 1; JNKK 1; JNK-activating kinase 1; MAPK/ERK kinase 4; MEK 4; SAPK/ERK kinase 1; SEK1

dual specificity mitogen-activated protein kinase kinase 4 isoform b; Dual specificity mitogen-activated protein kinase kinase 4; dual specificity mitogen-activated protein kinase kinase 4; mitogen-activated protein kinase kinase 4; C-JUN N-terminal kinase kinase 1; JNK kinase 1; JNKK 1; JNK-activating kinase 1; MAPK/ERK kinase 4; MEK 4; SAPK/ERK kinase 1; SEK1

Map2k4

Map2k4; Map2k4; MEK4; MKK4; Sek1; JNKK1; Serk1; PRKMK4; Jnkk1; Mek4; Mkk4; Prkmk4; Sek1; Serk1; Skk1; MAP kinase kinase 4; MAPKK 4; JNK kinase 1; JNKK 1; MEK 4; SEK1

MP2K4_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

2-397a

397

AAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRK
ALKLNFANPPVKSTARFTLNPNTTGVQNPHIERLRTHSI
ESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMV
HKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCP
YIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDD
VIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILL
DRSGNIKLCDFGISGQLVDSI

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Essential component of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. With MAP2K7/MKK7, is the one of the only known kinase to directly activate the stress-activated protein kinase/c-Jun N-terminal kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3. MAP2K4/MKK4 and MAP2K7/MKK7 both activate the JNKs by phosphorylation, but they differ in their preference for the phosphorylation site in the Thr-Pro-Tyr motif. MAP2K4 shows preference for phosphorylation of the Tyr residue and MAP2K7/MKK7 for the Thr residue. The phosphorylation of the Thr residue by MAP2K7/MKK7 ses to be the prerequisite for JNK activation at least in response to proinflammatory cytokines, while other stimuli activate both MAP2K4/MKK4 and MAP2K7/MKK7 which synergistically phosphorylate JNKs. MAP2K4 is required for maintaining peripheral lymphoid homeostasis. The MKK/JNK signaling pathway is also involved in mitochondrial death signaling pathway, including the release cytochrome c, leading to apoptosis. Whereas MAP2K7/MKK7 exclusively activates JNKs, MAP2K4/MKK4 additionally activates the p38 MAPKs MAPK11, MAPK12, MAPK13 and MAPK14.

Role of SAPK/ERK kinase-1 in the stress-activated pathway regulating transcription factor c-Jun.Sanchez I., Hughes R.T., Mayer B.J., Yee K., Woodgett J.R., Avruch J., Kyriakis J.M., Zon L.I.Nature 372:794-798(1994) Zon L.I.SEK1/MKK4 is required for maintenance of a normal peripheral lymphoid compartment but not for lymphocyte development.Swat W., Fujikawa K., Ganiatsas S., Yang D., Xavier R.J., Harris N.L., Davidson L., Ferrini R., Davis R.J., Labow M.A., Flavell R.A., Zon L.I., Alt F.W.Immunity 8:625-634(1998) The MKK7 gene encodes a group of c-Jun NH2-terminal kinase kinases.Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.Mol. Cell. Biol. 19:1569-1581(1999) Dynamic expression of SEK1 suggests multiple roles of the gene during embryogenesis and in adult brain of mice.Lee J.K., Hwang W.S., Lee Y.D., Han P.L.Brain Res. Mol. Brain Res. 66:133-140(1999) MKK7 is an essential component of the JNK signal transduction pathway activated by proinflammatory cytokines.Tournier C., Dong C., Turner T.K., Jones S.N., Flavell R.A., Davis R.J.Genes Dev. 15:1419-1426(2001) A subdomain of MEKK1 that is critical for binding to MKK4.Tu Z., Mooney S.M., Lee F.S.Cell. Signal. 15:65-77(2003) Different properties of SEK1 and MKK7 in dual phosphorylation of stress-induced activated protein kinase SAPK/JNK in embryonic stem cells.Kishimoto H., Nakagawa K., Watanabe T., Kitagawa D., Momose H., Seo J., Nishitai G., Shimizu N., Ohata S., Tanemura S., Asaka S., Goto T., Fukushi H., Yoshida H., Suzuki A., Sasaki T., Wada T., Penninger J.M., Nishina H., Katada T.J. Biol. Chem. 278:16595-16601(2003) Targeted deletion of the mitogen-activated protein kinase kinase 4 gene in the nervous system causes severe brain developmental defects and premature death.Wang X., Nadarajah B., Robinson A.C., McColl B.W., Jin J.W., Dajas-Bailador F., Boot-Handford R.P., Tournier C.Mol. Cell. Biol. 27:7935-7946(2007) Cardiac-specific deletion of mkk4 reveals its role in pathological hypertrophic remodeling but not in physiological cardiac growth.Liu W., Zi M., Jin J., Prehar S., Oceandy D., Kimura T.E., Lei M., Neyses L., Weston A.H., Cartwright E.J., Wang X.Circ. Res. 104:905-914(2009) Differential regulation and properties of MAPKs.Raman M., Chen W., Cobb M.H.Oncogene 26:3100-3112(2007) Diverse physiological functions of MKK4 and MKK7 during early embryogenesis.Asaoka Y., Nishina H.J. Biochem. 148:393-401(2010) The bottleneck of JNK signaling molecular and functional characteristics of MKK4 and MKK7.Haeusgen W., Herdegen T., Waetzig V.Eur. J. Cell Biol. 90:536-544(2011) JLP a scaffolding protein that tethers JNK/p38MAPK signaling modules and transcription factors.Lee C.M., Onesime D., Reddy C.D., Dhanasekaran N., Reddy E.P.Proc. Natl. Acad. Sci. U.S.A. 99:14189-14194(2002)

22095023

NP_033183.1

NM_009157.5

P47809

60kD

Activated TLR4 Signalling Pathway (1323703); Apoptosis Pathway (198339); Cellular Senescence Pathway (1324518); Cellular Responses To Stress Pathway (1324506); Chagas Disease (American Trypanosomiasis) Pathway (147810); Chagas Disease (American Trypanosomiasis) Pathway (147795); Epstein-Barr Virus Infection Pathway (585576); Epstein-Barr Virus Infection Pathway (587115); ErbB Signaling Pathway (83246); ErbB Signaling Pathway (458)

MKK4: dual specificity kinase of the STE7 family that phosphorylates and activates JNK1 and -2 as well as p38 but not ERK1 or -2. Mediates cellular responses to various cellular stresses and inflammatory cytokines. Phosphorylation by Akt inhibits MKK4 and suppresses stress-activated signal transduction. Protein type: Kinase, protein; EC 2.7.12.2; Protein kinase, dual-specificity (non-receptor); Protein kinase, STE; STE group; STE7 family. Cellular Component: axon; cytoplasm; cytosol; dendrite cytoplasm; nucleus; perikaryon. Molecular Function: ATP binding; JUN kinase kinase activity; kinase activity; MAP kinase kinase activity; mitogen-activated protein kinase kinase kinase binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; protein-tyrosine kinase activity; transferase activity. Biological Process: activation of JNK activity; activation of protein kinase activity; apoptosis; JNK cascade; MAPKKK cascade; phosphorylation; positive regulation of apoptosis; positive regulation of DNA replication; positive regulation of neuron apoptosis; positive regulation of nitric-oxide synthase biosynthetic process; positive regulation of protein amino acid phosphorylation; protein amino acid phosphorylation; regulation of mitotic cell cycle; response to wounding; stress-activated protein kinase signaling pathway

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

0.05 mg (Baculovirus)

1170

1 mg (E-Coli)

1180