catalog number :
MBS951440
products type :
Recombinant Protein
products full name :
Recombinant Dog Serum albumin
products short name :
Serum albumin
products name syn :
Allergen: Can f 3
other names :
serum albumin; Serum albumin; serum albumin; Allergen: Can f 3
other gene names :
ALB; ALB; CSA
uniprot entry name :
ALBU_CANLF
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
25-608
sequence :
EAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPFEDH
VKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVA
SLRDKYGDMADCCEKQEPDRNECFLAHKDDNPGFPPLVA
PEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY
YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAK
ERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKV
VTDLTKVHKECCHGDLLECAD
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Cardiovascular
products description :
Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca2+, Na+, K+, fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc.
products references :
Hilger C. Escherichia coli expression and purification of recombinant dog albumin, a cross-reactive animal allergen.Pandjaitan B., Swoboda I., Brandejsky-Pichler F., Rumpold H., Valenta R., Spitzauer S.J. Allergy Clin. Immunol. 105:279-285(2000)
Isolation of a cDNA encoding canine serum albumin.Miyake M., Okazaki M., Iwabuchi S. Isolation, amino acid sequence and copper(II)
-binding properties of peptide (1-24)
of dog serum albumin.Dixon J.W., Sarkar B.J. Biol. Chem. 249:5872-5877(1974)
HSC-2DPAGE and the two-dimensional gel electrophoresis database of dog heart proteins.Dunn M.J., Corbett J.M., Wheeler C.H.Electrophoresis 18:2795-2802(1997)
Molecular characterization of dog albumin as a cross-reactive allergen.Spitzauer S., Schweiger C., Sperr W.R., Pandjaitan B., Valent P., Muehl S., Ebner C., Scheiner O., Kraft D., Rumpold H.J. Allergy Clin. Immunol. 93:614-627(1994)
ncbi acc num :
NP_001003026.1
ncbi gb acc num :
NM_001003026.1
ncbi pathways :
Bile Acid And Bile Salt Metabolism Pathway (1339959); Binding And Uptake Of Ligands By Scavenger Receptors Pathway (1340221); HDL-mediated Lipid Transport Pathway (1339925); Hemostasis Pathway (1340332); Lipid Digestion, Mobilization, And Transport Pathway (1339920); Lipoprotein Metabolism Pathway (1339923); Metabolism Pathway (1339877); Metabolism Of Lipids And Lipoproteins Pathway (1339919); Platelet Activation, Signaling And Aggregation Pathway (1340342); Platelet Degranulation Pathway (1340354)