catalog number :
MBS951332
products type :
Recombinant Protein
products full name :
Recombinant Human Chromogranin-A
products short name :
Chromogranin-A
products name syn :
Pituitary secretory protein I; SP-I
other names :
chromogranin-A isoform 1 preproprotein; Chromogranin-A; chromogranin-A; chromogranin A; SL21
products gene name :
CHGA
other gene names :
CHGA; CHGA; CGA; CgA; SP-I
uniprot entry name :
CMGA_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
19-457; Mature full length protein
sequence :
LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECF
ETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKK
HSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKRED
SKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEE
EEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDR
EKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTV
VLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDP
EGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEE
RLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRD
SSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLP
LQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKV
AHQLQALRRG
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Cancer
products description :
Pancreastatin: Strongly inhibits glucose induced insulin release from the pancreas. Catestatin: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist. Displays antibacterial activity against Gram-positive bacteria S. aureus and M. luteus, and Gram-negative bacteria E Coli and P. aeruginosa. Can induce mast cell migration, degranulation and production of cytokines and chokines. Acts as a potent scavenger of free radicals in vitro. May play a role in the regulation of cardiac function and blood pressure.
products references :
The primary structure of human chromogranin A and pancreastatin.Konecki D.S., Benedum U.M., Gerdes H.-H., Huttner W.B.J. Biol. Chem. 262:17026-17030(1987)
ncbi acc num :
NP_001266.1
ncbi gb acc num :
NM_001275.3
ncbi summary :
The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Two other peptides, catestatin and chromofungin, have antimicrobial activity and antifungal activity, respectively. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
uniprot summary :
CHGA: a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells and is a precursor to multiple biologically active peptides including vasostatin, pancreastatin, and chromostatin. Binds calcium with a low-affinity. Vasostatin negatively regulates angiogenesis and has antibacterial activity against some Gram-positive bacteria. Pancreastatin inhibits glucose induced insulin release from the pancreas. Chromostatin inhibits catecholamine release from chromaffin cells. Protein type: Secreted, signal peptide; Secreted; Cell adhesion; Vesicle. Chromosomal Location of Human Ortholog: 14q32. Cellular Component: extracellular space; mast cell granule; perinuclear region of cytoplasm. Biological Process: defense response to fungus; defense response to Gram-negative bacterium; defense response to Gram-positive bacterium; innate immune response; killing of cells of another organism; mast cell activation; mast cell chemotaxis; mast cell cytokine production; mast cell degranulation; negative regulation of catecholamine secretion; negative regulation of vasodilation; organelle organization and biogenesis; ovulation cycle; positive regulation of cAMP metabolic process; regulation of blood pressure; regulation of the force of heart contraction