protein

Recombinant Mouse Natural resistance-associated macrophage protein 2 (Slc11a2)

MBS951104

1 mg (E Coli Derived

2220 USD

Recombinant Protein

Recombinant Mouse Natural resistance-associated macrophage protein 2 (Slc11a2)

Natural resistance-associated macrophage protein 2 (Slc11a2)

Recombinant Natural resistance-associated macrophage protein 2 (Slc11a2); Natural resistance-associated macrophage protein 2; NRAMP 2; Divalent cation transporter 1 Divalent metal transporter 1; DMT-1

natural resistance-associated macrophage protein 2 isoform 1; Natural resistance-associated macrophage protein 2; natural resistance-associated macrophage protein 2; DMT-1; NRAMP 2; divalent metal transporter 1; divalent cation transporter 1; microcytic anemia, viable anaemia; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2; Divalent cation transporter 1; Divalent metal transporter 1

Slc11a2; Dct1, Dmt1, Nramp2

Slc11a2; Slc11a2; mk; van; DCT1; DMT1; Nramp2; Dct1; Dmt1; Nramp2; NRAMP 2; DMT-1

NRAM2_MOUSE

E Coli or Yeast

1-568

568

MVLDPKEKMPDDGASGDHGDSASLGAINPAYSNSSLPHS
TGDSEEPFTTYFDEKIPIPEEEYSCFSFRKLWAFTGPGF
LMSIAYLDPGNIESDLQSGAVAGFKLLWVLLLATIVGLL
LQRLAARLGVVTGLHLAEVCHRQYPKVPRIILWLMVELA
IIGSDMQEVIGSAIAINLLSAGRVPLWGGVLITIADTFV
FLFLDKYGLRKLEAFFGFLITIMALTFGYEYITVKPSQS
QVLRGMFVPSCPGCRTPQVEQAVGIVGAVIMPHNMYLHS
ALVKSRQVNRANKQEVREANKYFFIESCIALFVSFIINV
FVVSVFAEAFFEKTNKQVVEVCKNNSSPHADLFPSDNST
LAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTG
TYSGQFVMEGFLNLKWSRFARVILTRSIAIIPTLLVAVF
QDVEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMS
EFSNGIGWRIAGGILVLIVCSINMYFVVVYVQELGHVAL
YVVAAVVSVAYLTFVFYLGWQCLIALGLSFLDCGRSYRL
GLTAQPELYLLNTVDADSVVSR

>90%

This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Mus musculus (Mouse)

Storage Buffer: PBS pH 7.4, 50% glycerol

225903448

NP_001139633.1

NM_001146161.1

P49282

62,368 Da

Iron Uptake And Transport Pathway 640295!!Lysosome Pathway 99272!!Lysosome Pathway 96865!!Metal Ion SLC Transporters Pathway 640277!!Mineral Absorption Pathway 212238!!Mineral Absorption Pathway 212220!!SLC-mediated Transmembrane Transport Pathway 640257!!Transmembrane Transport Of Small Molecules Pathway 640253!!Transport Of Glucose And Other Sugars, Bile Salts And Organic Acids, Metal Ions And Amine Compounds Pathway 640270

Function: Important in metal transport, in particular iron. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution. Ref.8 Ref.9. Subunit structure: Forms a complex with NDFIP1 and NEDD4L, in cortical neurons, in response to iron and colbalt exposure; this interaction leads to ubiquitination by NEDD4L and proteasome-dependent degradation. Interacts with NDFIP2 . By similarity. Subcellular location: Endosome membrane; Multi-pass membrane protein . By similarity. Tissue specificity: Isoform 2 is abundantly expressed in erythroid precursor cells (at protein level). Expressed at low levels in most tissues analyzed. Expressed at low levels in small intestine and at higher levels in kidney. Ref.7 Ref.8. Induction: Isoform 1 is up-regulated under iron-depletion conditions in the proximal portion of the duodenum where it is abundantly expressed in the brush border of absorptive epithelial cells (at protein level). Ref.7. Post-translational modification: Ubiquitinated by WWP2. Ref.11. Involvement in disease: Note=Defects in Slc11a2 are the cause of microcytic anemia (mk). Homozygous mk/mk mice have hypochromic microcytic anemia due to severe defects in intestinal iron absorption and erythroid iron utilization. Disruption phenotype: Mice display no apparent anatomical abnormalities. They are however anemic, show progressive postnatal growth retardation, and at birth have elevated liver iron stores compared with wild-type littermates. None survive for more than 7 days. Heterozygotes appear normal, showing no significant hematological abnormalities. However, by 8 weeks, their liver iron content is lower than in wild-type littermates. Ref.9. Miscellaneous: Nifedipine induces duodenal iron accumulation and mobilizes iron from the liver of iron-overloaded mice. Sequence similarities: Belongs to the NRAMP family. Sequence caution: The sequence CAD38518.1 differs from that shown. Reason: Frameshift at position 69.

1 mg (E Coli Derived)

2220 USD