Recombinant Mouse Toll-like receptor 7 | MyBioSource MBS951025 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Toll-like receptor 7

catalog :

MBS951025

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS951025

products type :

Recombinant Protein

products full name :

Recombinant Mouse Toll-like receptor 7

products short name :

Toll-like receptor 7

other names :

toll-like receptor 7 isoform a; Toll-like receptor 7; toll-like receptor 7; toll-like receptor 7

products gene name :

Tlr7

other gene names :

Tlr7; Tlr7

uniprot entry name :

TLR7_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

27-348; Provide the complete extracellular domain at the N-terminal.

sequence length :

348

sequence :

FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPT
NTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVL
LGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIP
QDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQN
CYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPT
TLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNC
PRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHS
NSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHF
LPNLVELDFS

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

products references :

Molecular cloning of murine Toll-like receptor 7.Heil F.J., Lipford G.B., Wagner H., Bauer S.M. Innate antiviral responses by means of TLR7-mediated recognition of single-stranded RNA.Diebold S.S., Kaisho T., Hemmi H., Akira S., Reis e Sousa C.Science 303:1529-1531(2004) The interaction between the ER membrane protein UNC93B and TLR3, 7, and 9 is crucial for TLR signaling.Brinkmann M.M., Spooner E., Hoebe K., Beutler B., Ploegh H.L., Kim Y.M.J. Cell Biol. 177:265-275(2007) UNC93B1 delivers nucleotide-sensing toll-like receptors to endolysosomes.Kim Y.M., Brinkmann M.M., Paquet M.E., Ploegh H.L.Nature 452:234-238(2008)

ncbi gi num :

595582289

ncbi acc num :

NP_001277684.1

ncbi gb acc num :

NM_001290755.1

uniprot acc num :

P58681

ncbi mol weight :

64.2kD

ncbi pathways :

Immune System Pathway (1323639); Influenza A Pathway (217174); Influenza A Pathway (217150); Innate Immune System Pathway (1323671); Measles Pathway (213308); Measles Pathway (213277); MyD88 Dependent Cascade Initiated On Endosome Pathway (1323695); TRAF6 Mediated IRF7 Activation In TLR7/8 Or 9 Signaling Pathway (1323699); TRAF6 Mediated Induction Of NFkB And MAP Kinases Upon TLR7/8 Or 9 Activation Pathway (1323696); Toll Like Receptor 7/8 (TLR7/8) Cascade Pathway (1323694)

uniprot summary :

TLR7: Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Interacts with MYD88 via their respective TIR domains. Interacts with UNC93B1. Detected in brain, placenta, spleen, stomach, small intestine, lung and in plasmacytoid pre-dendritic cells. Belongs to the Toll-like receptor family. Protein type: Membrane protein, integral. Cellular Component: cytoplasm; cytoplasmic vesicle; endoplasmic reticulum; endosome; integral to membrane; lysosome; membrane; plasma membrane; receptor complex. Molecular Function: double-stranded RNA binding; drug binding; protein binding; single-stranded RNA binding; siRNA binding; transmembrane receptor activity. Biological Process: defense response to virus; I-kappaB phosphorylation; immune response; immune system process; inflammatory response; innate immune response; microglial cell activation; MyD88-dependent toll-like receptor signaling pathway; positive regulation of chemokine production; positive regulation of interferon-alpha biosynthetic process; positive regulation of interferon-beta biosynthetic process; positive regulation of interferon-gamma biosynthetic process; positive regulation of interleukin-6 production; positive regulation of interleukin-8 biosynthetic process; positive regulation of interleukin-8 production; positive regulation of NF-kappaB import into nucleus; regulation of protein amino acid phosphorylation; signal transduction; toll-like receptor 7 signaling pathway; toll-like receptor signaling pathway

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

490

size3 :

0.5 mg (E-Coli)

price3 :

715

size4 :

0.05 mg (Baculovirus)

price4 :

950

size5 :

1 mg (E-Coli)

price5 :

1170

more info or order :

MyBioSource product webpage