product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Hemoglobin subunit beta (HBB)
catalog :
MBS950974
quantity :
1 mg (E Coli Derived
price :
1250 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS950974
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Hemoglobin subunit beta (HBB)
products short name :
(Rhesus macaque) Hemoglobin subunit beta (HBB)
products name syn :
Recombinant (Rhesus macaque) Hemoglobin subunit beta (HBB); Hemoglobin subunit beta; Beta-globin Hemoglobin beta chain
other names :
Hemoglobin subunit beta; Hemoglobin subunit beta; Beta-globin; Hemoglobin beta chain
products gene name syn :
HBB
other gene names :
HBB
uniprot entry name :
HBB_MACMU
host :
E Coli or Yeast
sequence positions :
1-146
sequence length :
146
sequence :
VHLTPEEKNAVTTLWGKVNVDEVGGEALGRLLLVYPWTQ
RFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLNHL
DNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHH
FGKEFTPQVQAAYQKVVAGVANALAHKYH
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Macaca mulatta (Rhesus macaque)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
122634
ncbi acc num :
P02026.1
uniprot acc num :
P02026
ncbi mol weight :
15,997 Da
ncbi pathways :
Focal Adhesion Pathway 83067!!Focal Adhesion Pathway 478!!MAPK Signaling Pathway 83048!!MAPK Signaling Pathway 456!!Salmonella Infection Pathway 375172!!Salmonella Infection Pathway 375149
uniprot summary :
Function: Involved in oxygen transport from the lung to the various peripheral tissues. Subunit structure: Heterotetramer of two alpha chains and two beta chains. Tissue specificity: Red blood cells. Sequence similarities: Belongs to the globin family.
size :
1 mg (E Coli Derived)
price :
1250 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!