product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse CD82 antigen
catalog :
MBS950941
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS950941
products type :
Recombinant Protein
products full name :
Recombinant Mouse CD82 antigen
products short name :
CD82 antigen
products name syn :
C33 antigen; IA4; Inducible membrane protein R2; Metastasis suppressor Kangai-1 homolog; CD82
other names :
CD82 antigen; CD82 antigen; CD82 antigen; CD82 antigen; C33 antigen; IA4; Inducible membrane protein R2; Metastasis suppressor Kangai-1 homolog; CD_antigen: CD82
products gene name :
Cd82
other gene names :
Cd82; Cd82; C33; IA4; Kai1; Tspan27; AA682076; AL023070; Kai1
uniprot entry name :
CD82_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
111-227
sequence length :
266
sequence :
DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKC
CGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIV
KKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
products references :
Mouse homologue of C33 antigen (CD82) , a member of the transmembrane 4 superfamily complementary DNA, genomic structure, and expression.Nagira M., Imai T., Ishikawa I., Uwabe K.I., Yoshie O.Cell. Immunol. 157:144-157(1994) The mouse C2C12 myoblast cell surface N-linked glycoproteome identification, glycosite occupancy, and membrane orientation.Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.Mol. Cell. Proteomics 8:2555-2569(2009)
ncbi gi num :
209862915
ncbi acc num :
NP_001129527.1
ncbi gb acc num :
NM_001136055.2
uniprot acc num :
P40237
ncbi mol weight :
29.5kD
ncbi pathways :
P53 Signaling Pathway (83252); P53 Signaling Pathway (465)
uniprot summary :
CD82: a widespread transmembrane protein of the tetraspanin family. A metastasis-suppressor whose decreased expression may be involved in malignant progression. Suppresses tumor metastasis of many cancers including cancers of the prostate, bladder, colon, cervix, liver, and lung (NSCLC). It is a target of estrogen receptor-mediated gene repression and is downregulated in primary human breast cancer. May be a prognostic marker for lung cancer and tumor metastatic potential. Interacts with cell surface proteins including integrins, cadherins, CD4, CD8, IGSF8. Modulates EGFR signaling. May suppress invasion by inhibiting integrin-dependent crosstalk with c-Met receptor and Src kinases. Its regulation of c-Met signaling apparently affects cancer cell migration. Protein type: Membrane protein, integral; Membrane protein, multi-pass; Cell surface. Cellular Component: integral to membrane; integral to plasma membrane; membrane. Biological Process: cell surface receptor linked signal transduction
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
size5 :
1 mg (Yeast)
price5 :
1985
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!