product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Cytochrome P450 3A4 (CYP3A4)
catalog :
MBS950919
quantity :
0.05 mg (E-Coli)
price :
305 USD
more info or order :
product information
catalog number :
MBS950919
products type :
Recombinant Protein
products full name :
Recombinant Human Cytochrome P450 3A4 (CYP3A4)
products short name :
Cytochrome P450 3A4 (CYP3A4)
products name syn :
Cytochrome P450 3A4; EC=1.14.13.-; Albendazole monooxygenase; EC=1.14.13.32; Albendazole sulfoxidase; CYPIIIA3; CYPIIIA4; Cytochrome P450 3A3; Cytochrome P450 HLp; Cytochrome P450 NF-25; Cytochrome P450-PCN1; Nifedipine oxidase; Quinine 3-monooxygenase; E
other names :
cytochrome P450 3A4 isoform 2; Cytochrome P450 3A4; cytochrome P450 3A4; nifedipine oxidase; cytochrome P450 3A3; cytochrome P450 HLp; cytochrome P450-PCN1; cytochrome P450 NF-25; albendazole sulfoxidase; quinine 3-monooxygenase; albendazole monooxygenase; P450-III, steroid inducible; glucocorticoid-inducible P450; 1,8-cineole 2-exo-monooxygenase; taurochenodeoxycholate 6-alpha-hydroxylase; cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3; cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4; cytochrome P450, family 3, subfamily A, polypeptide 4; 1,8-cineole 2-exo-monooxygenase (EC:1.14.13.157); Albendazole monooxygenase (EC:1.14.13.32); Albendazole sulfoxidase; CYPIIIA3; CYPIIIA4; Cytochrome P450 3A3; Cytochrome P450 HLp; Cytochrome P450 NF-25; Cytochrome P450-PCN1; Nifedipine oxidase; Quinine 3-monooxygenase (EC:1.14.13.67); Taurochenodeoxycholate 6-alpha-hydroxylase (EC:1.14.13.97)
products gene name :
CYP3A4
products gene name syn :
CYP3A4; CYP3A3
other gene names :
CYP3A4; CYP3A4; HLP; CP33; CP34; CYP3A; NF-25; CYP3A3; P450C3; CYPIIIA3; CYPIIIA4; P450PCN1; CYP3A3
uniprot entry name :
CP3A4_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-503, Full length.
sequence length :
503
sequence :
ALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPG
PTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQ
PVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAI
SIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLV
RNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSL
NNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEV
LNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQL
MIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSV
LSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQ
MEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKG
VVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPY
IYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCK
ETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Homo sapiens (Human)
products description :
CYP3A4; CYP3A3
ncbi gi num :
322302351
ncbi acc num :
NP_001189784.1
ncbi gb acc num :
NM_001202855.2
uniprot acc num :
P08684
ncbi mol weight :
57,343 Da
ncbi pathways :
Aflatoxin B1 Metabolism Pathway (198808); Benzo(a)pyrene Metabolism Pathway (198911); Bile Secretion Pathway (193146); Bile Secretion Pathway (193095); Biological Oxidations Pathway (105698); Chemical Carcinogenesis Pathway (673221); Chemical Carcinogenesis Pathway (673237); Codeine And Morphine Metabolism Pathway (198831); Cytochrome P450 - Arranged By Substrate Type Pathway (105700); Drug Induction Of Bile Acid Pathway (698755)
ncbi summary :
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Feb 2011]
uniprot summary :
CYP3A4: Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e.g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1 -hydroxylation and midazolam 4- hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,8-cineole 2- exo-monooxygenase. The enzyme also hydroxylates etoposide. Belongs to the cytochrome P450 family. Protein type: Oxidoreductase; Lipid Metabolism - linoleic acid; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Xenobiotic Metabolism - metabolism by cytochrome P450; EC 1.14.14.1; Xenobiotic Metabolism - drug metabolism - other enzymes; Cofactor and Vitamin Metabolism - retinol; Cell surface; Membrane protein, integral. Chromosomal Location of Human Ortholog: 7q21.1. Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; cytoplasm; integral to membrane. Molecular Function: quinine 3-monooxygenase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; albendazole monooxygenase activity; taurochenodeoxycholate 6alpha-hydroxylase activity; oxidoreductase activity; oxygen binding; testosterone 6-beta-hydroxylase activity; steroid binding; vitamin D3 25-hydroxylase activity; enzyme binding; iron ion binding; heme binding; steroid hydroxylase activity; monooxygenase activity. Biological Process: steroid metabolic process; drug catabolic process; xenobiotic metabolic process; androgen metabolic process; exogenous drug catabolic process; monoterpenoid metabolic process; alkaloid catabolic process; heterocycle metabolic process; lipid metabolic process; drug metabolic process; steroid catabolic process; vitamin D metabolic process
size1 :
0.05 mg (E-Coli)
price1 :
305 USD
size2 :
0.2 mg (E-Coli)
price2 :
580
size3 :
0.05 mg (Baculovirus)
price3 :
950
size4 :
0.5 mg (E-Coli)
price4 :
950
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1170
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!