catalog number :
MBS950838
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-10 (IL10)
products short name :
(Rhesus macaque) Interleukin-10 (IL10)
products name syn :
Recombinant (Rhesus macaque) Interleukin-10 (IL10); Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF
other names :
interleukin-10; Interleukin-10; Cytokine synthesis inhibitory factor
products gene name syn :
IL10
other gene names :
IL10; IL-10; CSIF
uniprot entry name :
IL10_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
19-178
sequence :
LGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSK AVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQM
KDQLDNILLKESLLEDFKGY
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
products description :
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
ncbi acc num :
NP_001038192.1
ncbi gb acc num :
NP_001038192.1
ncbi pathways :
African Trypanosomiasis Pathway (194389); African Trypanosomiasis Pathway (194323); Allograft Rejection Pathway (86789); Allograft Rejection Pathway (535); Amoebiasis Pathway (167336); Amoebiasis Pathway (167191); Asthma Pathway (86786); Asthma Pathway (532); Autoimmune Thyroid Disease Pathway (86787); Autoimmune Thyroid Disease Pathway (533)
uniprot summary :
Function: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells . By similarity. Subunit structure: Homodimer . By similarity. Subcellular location: Secreted. Sequence similarities: Belongs to the IL-10 family.