This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-10 (IL10)
catalog :
MBS950838
quantity :
1 mg (E-Coli)
price :
1285 USD
product information
catalog number :
MBS950838
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-10 (IL10)
products short name :
(Rhesus macaque) Interleukin-10 (IL10)
products name syn :
Recombinant (Rhesus macaque) Interleukin-10 (IL10); Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF
other names :
interleukin-10; Interleukin-10; Cytokine synthesis inhibitory factor
products gene name syn :
IL10
other gene names :
IL10; IL-10; CSIF
uniprot entry name :
IL10_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
19-178
sequence length :
178
sequence :
LGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSK AVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQM
KDQLDNILLKESLLEDFKGY
purity :
>90%(SDS-PAGE)
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
products description :
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
ncbi gi num :
113461947
ncbi acc num :
NP_001038192.1
ncbi gb acc num :
NP_001038192.1
uniprot acc num :
P51496
ncbi mol weight :
18KD
ncbi pathways :
African Trypanosomiasis Pathway (194389); African Trypanosomiasis Pathway (194323); Allograft Rejection Pathway (86789); Allograft Rejection Pathway (535); Amoebiasis Pathway (167336); Amoebiasis Pathway (167191); Asthma Pathway (86786); Asthma Pathway (532); Autoimmune Thyroid Disease Pathway (86787); Autoimmune Thyroid Disease Pathway (533)
uniprot summary :
Function: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells . By similarity. Subunit structure: Homodimer . By similarity. Subcellular location: Secreted. Sequence similarities: Belongs to the IL-10 family.
size1 :
1 mg (E-Coli)
price1 :
1285 USD
size2 :
1 mg (Yeast)
price2 :
1740
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!