protein

Recombinant Human B-lymphocyte antigen CD20

MBS950769

INQUIRE

INQUIRE

Recombinant Protein

Recombinant Human B-lymphocyte antigen CD20

B-lymphocyte antigen CD20

B-lymphocyte surface antigen B1Bp35; Leukocyte surface antigen Leu-16; Membrane-spanning 4-domains subfamily A member 1; CD20

B-lymphocyte antigen CD20; B-lymphocyte antigen CD20; B-lymphocyte antigen CD20; membrane spanning 4-domains A1; B-lymphocyte surface antigen B1; Bp35; Leukocyte surface antigen Leu-16; Membrane-spanning 4-domains subfamily A member 1; CD_antigen: CD20

MS4A1

MS4A1; MS4A1; B1; S7; Bp35; CD20; CVID5; MS4A2; LEU-16; CD20

CD20_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

141-297

130

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPS
TQYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKR
TCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPK
NEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSS
P

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Immunology

This protein may be involved in the regulation of B-cell activation and proliferation.

Analysis of two cDNA clones encoding the B lymphocyte antigen CD20 (B1, Bp35) , a type III integral membrane protein.Stamenkovic I., Seed B.J. Exp. Med. 167:1975-1980(1988) Isolation and structure of a cDNA encoding the B1 (CD20) cell-surface antigen of human B lymphocytes.Tedder T.F., Streuli M., Schlossman S.F., Saito H.Proc. Natl. Acad. Sci. U.S.A. 85:208-212(1988) Molecular cloning of the human B cell CD20 receptor predicts a hydrophobic protein with multiple transmembrane domains.Einfeld D.A., Brown J.P., Valentine M.A., Clark E.A., Ledbetter J.A.EMBO J. 7:711-717(1988) Structure of the gene encoding the human B lymphocyte differentiation antigen CD20 (B1) .Tedder T.F., Klejman G., Schlossman S.F., Saito H.J. Immunol. 142:2560-2568(1989) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)

23110987

NP_068769.2

NM_021950.3

P11836

20kD

Hematopoietic Cell Lineage Pathway (83078); Hematopoietic Cell Lineage Pathway (489)

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. [provided by RefSeq, Jul 2008]

MS4A1: This protein may be involved in the regulation of B-cell activation and proliferation. Defects in MS4A1 are the cause of immunodeficiency common variable type 5 (CVID5); also called antibody deficiency due to CD20 defect. CVID5 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. Belongs to the MS4A family. Protein type: Cell surface; Membrane protein, integral; Membrane protein, multi-pass. Chromosomal Location of Human Ortholog: 11q12. Cellular Component: external side of plasma membrane; extracellular space; integral to plasma membrane. Molecular Function: epidermal growth factor receptor binding; protein binding. Biological Process: B cell proliferation; humoral immune response. Disease: Immunodeficiency, Common Variable, 5

INQUIRE

INQUIRE