catalog number :
MBS950761
products type :
Recombinant Protein
products full name :
Recombinant Human Neurofilament light polypeptide (NEFL)
products short name :
[Neurofilament light polypeptide (NEFL)]
products name syn :
[Neurofilament light polypeptide; NF-L; 68 kDa neurofilament protein; Neurofilament triplet L protein]
other names :
[neurofilament light polypeptide; Neurofilament light polypeptide; neurofilament light polypeptide; neurofilament subunit NF-L; neurofilament triplet L protein; neurofilament protein, light chain; neurofilament, light polypeptide 68kDa; light molecular weight neurofilament protein; protein phosphatase 1, regulatory subunit 110; neurofilament, light polypeptide; 68 kDa neurofilament protein; Neurofilament triplet L protein]
products gene name :
[NEFL]
products gene name syn :
[NEFL; NF68; NFL]
other gene names :
[NEFL; NEFL; NFL; NF-L; NF68; CMT1F; CMT2E; PPP1R110; NF68; NFL; NF-L]
uniprot entry name :
NFL_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[2-543. Full Length of Mature Protein]
sequence :
SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAY
SSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAI
SNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVL
EAELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEK
QALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEAR
KGADEAALARAELEKRIDSLMDEISFLKKVHEEEIAELQ
AQIQYAQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQ
NAEEWFKSRFTVLTESAAKNTDAVRAAKDEVSESRRLLK
AKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTIN
KLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRK
LLEGEETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTS
SYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDE
PPSEGEAEEEEKDKEEAEEEEAAEEEEAAKEESEEAKEE
EEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Homo sapiens (Human)
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber.
ncbi acc num :
NP_006149.2
ncbi gb acc num :
NM_006158.4
ncbi mol weight :
61,517 Da
ncbi pathways :
Activation Of NMDA Receptor Upon Glutamate Binding And Postsynaptic Events Pathway (161033); Amyotrophic Lateral Sclerosis (ALS) Pathway (83099); Amyotrophic Lateral Sclerosis (ALS) Pathway (511); CREB Phosphorylation Through The Activation Of CaMKII Pathway (161040); CREB Phosphorylation Through The Activation Of Ras Pathway (161036); Neuronal System Pathway (106513); Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell Pathway (106534); Post NMDA Receptor Activation Events Pathway (161035); Ras Activation Uopn Ca2+ Infux Through NMDA Receptor Pathway (161037); Transmission Across Chemical Synapses Pathway (106516)
ncbi summary :
Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene encodes the light chain neurofilament protein. Mutations in this gene cause Charcot-Marie-Tooth disease types 1F (CMT1F) and 2E (CMT2E), disorders of the peripheral nervous system that are characterized by distinct neuropathies. A pseudogene has been identified on chromosome Y. [provided by RefSeq, Oct 2008]
uniprot summary :
NFL: one of the three (L, M, and H) intermediate filament proteins that form neurofilaments. Neurofilaments are involved in the maintenance of neuronal caliber. NF-L is the most abundant of the three neurofilament proteins. Defects cause Charcot-Marie-Tooth disease type 1F (CMT1F). Protein type: Cytoskeletal. Chromosomal Location of Human Ortholog: 8p21. Cellular Component: TSC1-TSC2 complex; growth cone; axon; cytoplasm; neurofilament; cytosol. Molecular Function: protein binding, bridging; protein C-terminus binding; protein domain specific binding; identical protein binding; protein binding; phospholipase binding; structural constituent of cytoskeleton. Biological Process: protein polymerization; response to peptide hormone stimulus; neurofilament bundle assembly; response to toxin; intermediate filament organization; microtubule cytoskeleton organization and biogenesis; axon regeneration in the peripheral nervous system; retrograde axon cargo transport; synaptic transmission; axon transport of mitochondrion; regulation of axon diameter; positive regulation of axonogenesis; negative regulation of neuron apoptosis; anterograde axon cargo transport; neuromuscular process controlling balance; locomotion; neurite morphogenesis; response to corticosterone stimulus. Disease: Charcot-marie-tooth Disease, Axonal, Type 2e; Charcot-marie-tooth Disease, Demyelinating, Type 1f
size8 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size12 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size14 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)