catalog number :
MBS950756
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Tumor necrosis factor (TNF)
products short name :
(Rhesus macaque) Tumor necrosis factor (TNF)
products name syn :
Recombinant (Rhesus macaque) Tumor necrosis factor (TNF); Tumor necrosis factor; Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2; TNF-a Cleaved into the following 6 chains: 1. Tumor necrosis factor, membrane form; N-terminal fragment
other names :
tumor necrosis factor; Tumor necrosis factor; tumor necrosis factor; TNF-a; cachectin; tumor necrosis factor alpha; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor ligand superfamily member 2; ATP-binding cassette, sub-family F (GCN20), member 1; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-aCleaved into the following 6 chains:Tumor necrosis factor, membrane form; Alternative name(s):; N-terminal fragment
products gene name syn :
TNF; TNFA, TNFSF2
other gene names :
TNF; TNF; TNF-ALPHA; TNFA; TNFSF2; TNF-a; NTF; ICD1; ICD2
uniprot entry name :
TNFA_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
57-233
sequence :
GPQREEFPKDPSLISPLAQAVRSSSRTPSDKPVAHVVAN
PQAEGQLQWLNRRANALLANGVELTDNQLVVPSEGLYLI
YSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAI
KSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEI
NLPDYLDFAESGQVYFGIIAL
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi acc num :
NP_001040614.1
ncbi gb acc num :
NM_001047149.1
ncbi mol weight :
25,630 Da
ncbi pathways :
Adipocytokine Signaling Pathway (86763); Adipocytokine Signaling Pathway (505); African Trypanosomiasis Pathway (194389); African Trypanosomiasis Pathway (194323); Allograft Rejection Pathway (86789); Allograft Rejection Pathway (535); Alzheimer's Disease Pathway (86767); Alzheimer's Disease Pathway (509); Amoebiasis Pathway (167336); Amoebiasis Pathway (167191)
uniprot summary :
Function: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells . By similarity. Subunit structure: Homotrimer. Interacts with SPPL2B . By similarity. Subcellular location: Cell membrane; Single-pass type II membrane protein . By similarity. Tumor necrosis factor, membrane form: Membrane; Single-pass type II membrane protein . By similarity. Tumor necrosis factor, soluble form: Secreted . By similarity. C-domain 1: Secreted . By similarity. C-domain 2: Secreted . By similarity. Post-translational modification: The soluble form derives from the membrane form by proteolytic processing. The membrane-bound form is further proteolytically processed by SPPL2A or SPPL2B through regulated intramembrane proteolysis producing TNF intracellular domains (ICD1 and ICD2) released in the cytosol and TNF C-domain 1 and C-domain 2 secreted into the extracellular space . By similarity.The membrane form, but not the soluble form, is phosphorylated on serine residues. Dephosphorylation of the membrane form occurs by binding to soluble TNFRSF1A/TNFR1 . By similarity.O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid . By similarity. Sequence similarities: Belongs to the tumor necrosis factor family.