product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human 3-ketoacyl-CoA thiolase, mitochondrial
catalog :
MBS950688
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS950688
products type :
Recombinant Protein
products full name :
Recombinant Human 3-ketoacyl-CoA thiolase, mitochondrial
products short name :
3-ketoacyl-CoA thiolase
products name syn :
Acetyl-CoA acyltrans ferase; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1
other names :
3-ketoacyl-CoA thiolase, mitochondrial; 3-ketoacyl-CoA thiolase, mitochondrial; 3-ketoacyl-CoA thiolase, mitochondrial; acetyl-CoA acyltransferase 2; Acetyl-CoA acyltransferase; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1
products gene name :
ACAA2
other gene names :
ACAA2; ACAA2; DSAEC
uniprot entry name :
THIM_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
17-397
sequence length :
397
sequence :
FGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVI
MGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRLCGS
GFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVR
FGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKH
KISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTK
KGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNA
SGVADGAGAVIIASEDAVKKH
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Metabolism
products description :
Abolishes BNIP3-mediated apoptosis and mitochondrial damage.
products references :
Cloning and sequence analysis of a full length cDNA encoding human mitochondrial 3-oxoacyl-CoA thiolase.Abe H., Ohtake A., Yamamoto S., Satoh Y., Takayanagi M., Amaya Y., Takiguchi M., Sakuraba H., Suzuki Y., Mori M., Niimi H.Biochim. Biophys. Acta 1216:304-306(1993) Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes.Aboulaich N., Vainonen J.P., Stralfors P., Vener A.V.Biochem. J. 383:237-248(2004) Acetyl-Coenzyme A acyltransferase 2 attenuates the apoptotic effects of BNIP3 in two human cell lines.Cao W., Liu N., Tang S., Bao L., Shen L., Yuan H., Zhao X., Lu H.Biochim. Biophys. Acta 1780:873-880(2008) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
ncbi gi num :
167614485
ncbi acc num :
NP_006102.2
ncbi gb acc num :
NM_006111.2
uniprot acc num :
P42765
ncbi mol weight :
44.3kD
ncbi pathways :
Fatty Acid Biosynthesis Pathway (198873); Fatty Acid Biosynthesis, Elongation, Mitochondria Pathway (413380); Fatty Acid Biosynthesis, Elongation, Mitochondria Pathway (468246); Fatty Acid Degradation Pathway (82935); Fatty Acid Degradation Pathway (296); Fatty Acid Elongation Pathway (82934); Fatty Acid Elongation Pathway (295); Fatty Acid Metabolism Pathway (868084); Fatty Acid Metabolism Pathway (878045); Metabolic Pathways (132956)
ncbi summary :
The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq, Jul 2008]
uniprot summary :
ACAA2: Abolishes BNIP3-mediated apoptosis and mitochondrial damage. Belongs to the thiolase family. Protein type: Lipid Metabolism - fatty acid; Lipid Metabolism - fatty acid elongation in mitochondria; Amino Acid Metabolism - valine, leucine and isoleucine degradation; EC 2.3.1.16; Transferase. Chromosomal Location of Human Ortholog: 18q21.1. Cellular Component: mitochondrial inner membrane; mitochondrion. Molecular Function: acetyl-CoA C-acyltransferase activity; protein binding. Biological Process: cholesterol biosynthetic process; fatty acid metabolic process
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (E-Coli)
price5 :
750
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!