product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-6 (IL6)
catalog :
MBS950670
quantity :
1 mg (E-Coli)
price :
1340 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS950670
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-6 (IL6)
products short name :
(Rhesus macaque) Interleukin-6 (IL6)
products name syn :
Recombinant (Rhesus macaque) Interleukin-6 (IL6); Interleukin-6; IL-6
other names :
interleukin-6; Interleukin-6; interleukin-6; IL-6
products gene name syn :
IL6
other gene names :
IL6; IL6; IL-6
uniprot entry name :
IL6_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
28-212
sequence length :
212
sequence :
APVLPGEDSKNVAAPHSQPLTSSERIDKHIRYILDGISA
LRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSG
FNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQ
MSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQN
QWLQDMTTHLILRSFKEFLQSNLRALRQM
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
112293291
ncbi acc num :
NP_001036198.1
ncbi gb acc num :
NM_001042733.1
uniprot acc num :
P51494
ncbi mol weight :
23,728 Da
ncbi pathways :
African Trypanosomiasis Pathway (194389); African Trypanosomiasis Pathway (194323); Amoebiasis Pathway (167336); Amoebiasis Pathway (167191); Chagas Disease (American Trypanosomiasis) Pathway (147811); Chagas Disease (American Trypanosomiasis) Pathway (147795); Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460); Cytosolic DNA-sensing Pathway (125154); Cytosolic DNA-sensing Pathway (124833)
uniprot summary :
Function: Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance . By similarity. Subcellular location: Secreted. Sequence similarities: Belongs to the IL-6 superfamily.
size1 :
1 mg (E-Coli)
price1 :
1340 USD
size2 :
1 mg (Yeast)
price2 :
1800
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!