catalog number :
MBS950658
products type :
Recombinant Protein
products full name :
Recombinant Human Cardiac phospholamban
products short name :
Cardiac phospholamban
other names :
cardiac phospholamban; Cardiac phospholamban; cardiac phospholamban; phospholamban
other gene names :
PLN; PLN; PLB; CMD1P; CMH18; PLB; PLB
uniprot entry name :
PPLA_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
Jan-52
sequence :
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLIL
ICLLLICIIVMLL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Cardiovascular
ncbi acc num :
NP_002658.1
ncbi gb acc num :
NM_002667.3
ncbi mol weight :
33.51kD
ncbi pathways :
Adrenergic Signaling In Cardiomyocytes Pathway (908257); Adrenergic Signaling In Cardiomyocytes Pathway (909696); Calcium Regulation In The Cardiac Cell Pathway (198906); Calcium Signaling Pathway (83050); Calcium Signaling Pathway (459); Cardiac Conduction Pathway (1339115); Dilated Cardiomyopathy Pathway (121494); Dilated Cardiomyopathy Pathway (121285); Integrated Pancreatic Cancer Pathway (711360); Ion Channel Transport Pathway (1269950)
ncbi summary :
The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure. [provided by RefSeq, Jul 2008]
uniprot summary :
PLB: a heart protein postulated to regulate the activity of the calcium pump of cardiac sarcoplasmic reticulum. A major substrate for the cAMP-dependent protein kinase. An inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. A key regulator of cardiac diastolic function. Mutations are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure. Protein type: Membrane protein, integral; Inhibitor. Chromosomal Location of Human Ortholog: 6q22.1. Cellular Component: cytosol; endoplasmic reticulum; membrane; mitochondrial membrane; mitochondrion; perinuclear region of cytoplasm; sarcoplasmic reticulum membrane; vesicle. Molecular Function: ATPase binding; ATPase inhibitor activity; calcium channel regulator activity; enzyme inhibitor activity; identical protein binding; protein binding. Biological Process: blood circulation; calcium ion transport; cardiac muscle development; cytosolic calcium ion homeostasis; negative regulation of ATPase activity; negative regulation of calcium ion transport; negative regulation of catalytic activity; negative regulation of heart rate; Notch signaling pathway; protein homooligomerization; regulation of calcium ion transport; regulation of heart contraction; regulation of the force of heart contraction; response to insulin stimulus; response to testosterone stimulus; response to zinc ion. Disease: Cardiomyopathy, Dilated, 1p; Cardiomyopathy, Familial Hypertrophic, 18