Recombinant Macaca mulatta (Rhesus macaque) Ly-6/neurotoxin-like protein 1 (LYNX1) | MyBioSource MBS950651 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Macaca mulatta (Rhesus macaque) Ly-6/neurotoxin-like protein 1 (LYNX1)

catalog :

MBS950651

quantity :

1 mg (E-Coli)

price :

1085 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS950651

products type :

Recombinant Protein

products full name :

Recombinant Macaca mulatta (Rhesus macaque) Ly-6/neurotoxin-like protein 1 (LYNX1)

products short name :

(Rhesus macaque) Ly-6/neurotoxin-like protein 1 (LYNX1)

products name syn :

Recombinant (Rhesus macaque) Ly-6/neurotoxin-like protein 1 (LYNX1); Ly-6/neurotoxin-like protein 1

other names :

ly-6/neurotoxin-like protein 1; Ly-6/neurotoxin-like protein 1; ly-6/neurotoxin-like protein 1; Ly-6 neurotoxin-like protein 1

products gene name syn :

LYNX1

other gene names :

LYNX1; LYNX1

uniprot entry name :

LYNX1_MACMU

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

23-95

sequence length :

131

sequence :

LDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTPTRMK
VSKSCVPSCFETVYDGYSKHASTTSCCQYDLCNS

purity :

>90%

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

other info1 :

Species: Macaca mulatta (Rhesus macaque)

ncbi gi num :

74136439

ncbi acc num :

NP_001028116.1

ncbi gb acc num :

NM_001032944.1

uniprot acc num :

P61050

ncbi mol weight :

14,090 Da

uniprot summary :

Function: Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs). Isoforms 2/4 modulates functional properties of nicotinic acetylcholine receptors (nAChRs) to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha4beta2 nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha4beta2 nAChRs . By similarity. Prevents plasticity in the primary visual cortex late in life . By similarity. In keratinocytes, isoform 3 delays differentiation and prevents apoptosis . By similarity. Subunit structure: Interacts with nAChRs, including alpha4beta2 (CHRNA4/CHRNB2) and alpha7 (CHRNA7) . By similarity. Subcellular location: Isoform 1: Secreted . Potential Ref.1. Isoform 2: Cell membrane; Lipid-anchor GPI-anchor . Potential Ref.1. Cell projection dendrite . By similarity. Note: Detected in Purkinje cells soma and proximal dendrites . By similarity. Colocalizes with different types of nAChRs. Ref.1Isoform 3: Secreted . By similarity Ref.1. Isoform 4: Cell membrane; Lipid-anchor GPI-anchor . Potential Ref.1. Tissue specificity: Expressed in brain. Isoforms 2/4 expressed in lung. In the lung, expressed predominantly in airway epithelial cells, submucous glands, and smooth muscle cells, in endothelial and smooth muscle cells in vessel walls and in alveolar type II cells (at protein level). Ref.1. Developmental stage: Detected as early as day 71 of gestation. Expression increases consistently in lungs throughout the prenatal period. After birth, expression continues well into adulthood. At 71 days of gestation (pseudoglandular phase), expression is detected in tracheal and proximal conducting airway epithelium. Expression decreases gradually toward the distal airways. Strong expression in the epithelium lining the tips of the dichotomous and monopodial airway buds. Weakly expressed in smooth muscle cells around the large airways. Weakly expressed in mesenchymal cells and not at all in the mesenchymal cells surrounding the airway buds. Not detected in vessels associated with large airways (at protein level). At 94 days of gestation, similar expression pattern, but expression increases and extends toward distal airway epithelium. Strong expression in type II cells that line the primitive air spaces of late canalicular and early saccular phase. More prominent expression in the smooth muscle cells surrounding the large airways. Begins to be weakly expressed in endothelial and smooth muscle cells in large vessels, but not in small distal vessels (at protein level). At day 134 of gestation, further increase in expression in the distal airway epithelium. In large airways, predominantly expressed in the ciliated epithelium. Expressed at low levels in the mucus-secreting cells and at high levels in the submucosal gland cells. Weakly expressed in paracartilaginous cells, but not in cells in the extra-cartilaginous layer. Not detected in type I alveolar cells. Strongly expressed in endothelial and smooth muscle cells increased in large vessels and in distal vessels (at protein level). At birth, similar pattern of expression. Slightly decreased expression in the proximal airways (at protein level). Ref.1. Induction: Up-regulated by prenatal nicotine exposure. Ref.1. Sequence similarities: Contains 1 UPAR/Ly6 domain.

size1 :

1 mg (E-Coli)

price1 :

1085 USD

size2 :

1 mg (Yeast)

price2 :

1540

more info or order :

MyBioSource product webpage