protein

Recombinant Rat Dipeptidyl aminopeptidase-like protein 6

MBS950622

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Rat Dipeptidyl aminopeptidase-like protein 6

Dipeptidyl aminopeptidase-like protein 6

DPPX; Dipeptidyl aminopeptidase-related protein; Dipeptidyl peptidase 6; Dipeptidyl peptidase IV-like protein; Dipeptidyl peptidase VI; DPP VI

dipeptidyl aminopeptidase-like protein 6; Dipeptidyl aminopeptidase-like protein 6; dipeptidyl aminopeptidase-like protein 6; dipeptidyl peptidase like 6; DPPX; Dipeptidyl aminopeptidase-related protein; Dipeptidyl peptidase 6; Dipeptidyl peptidase IV-like protein; Dipeptidyl peptidase VI; DPP VI

DPP6

Dpp6; Dpp6; DPP VI; DPP VI

DPP6_RAT

E Coli or Yeast or Baculovirus or Mammalian Cell

111-859

803

LTPAEDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISDKE
FIYRERKGSVILRNVETNNSTVLIEGKKIESLRAIRYEI
SPDKEYALFSYNVEPVYQHSHTGYYVLSKIPHGDPQSLD
PPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQA
IRVVSTGKEGVIYNGLSDWLYEEEILKSHIAHWWSPDGT
RLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSE
NPSISLHVIGLNGPTHDLEMM

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Promotes cell surface expression of the potassium channel KCND2. Modulates the activity and gating characteristics of the potassium channel KCND2. Has no dipeptidyl aminopeptidase activity.

Differential expression of two distinct forms of mRNA encoding members of a dipeptidyl aminopeptidase family.Wada K., Yokotani N., Hunter C., Doi K., Wenthold R.J., Shimasaki S.Proc. Natl. Acad. Sci. U.S.A. 89:197-201(1992) The CD26-related dipeptidyl aminopeptidase-like protein DPPX is a critical component of neuronal A-type K+ channels.Nadal M.S., Ozaita A., Amarillo Y., Vega-Saenz de Miera E., Ma Y., Mo W., Goldberg E.M., Misumi Y., Ikehara Y., Neubert T.A., Rudy B.Neuron 37:449-461(2003) Multiprotein assembly of Kv4.2, KChIP3 and DPP10 produces ternary channel complexes with ISA-like properties.Jerng H.H., Kunjilwar K., Pfaffinger P.J.J. Physiol. (Lond.) 568:767-788(2005) A novel N-terminal motif of dipeptidyl peptidase-like proteins produces rapid inactivation of KV4.2 channels by a pore-blocking mechanism.Jerng H.H., Dougherty K., Covarrubias M., Pfaffinger P.J.Channels 3:448-461(2009) The dipeptidyl-peptidase-like protein DPP6 determines the unitary conductance of neuronal Kv4.2 channels.Kaulin Y.A., De Santiago-Castillo J.A., Rocha C.A., Nadal M.S., Rudy B., Covarrubias M.J. Neurosci. 29:3242-3251(2009)

12408298

NP_074041.1

NM_022850.1

P46101

89.6kD

may mediate metabolism of localized peptides [RGD, Feb 2006]

DPP6: May be involved in the physiological processes of brain function. Has no dipeptidyl aminopeptidase activity. May modulate the cell surface expression and the activity of the potassium channel KCND2. Defects in DPP6 are the cause of familial paroxysmal ventricular fibrillation type 2 (VF2). A cardiac arrhythmia marked by fibrillary contractions of the ventricular muscle due to rapid repetitive excitation of myocardial fibers without coordinated contraction of the ventricle and by absence of atrial activity. A genetic variation 340 bases upstream from the ATG start site of the DPP6 gene is the cause of familial paroxysmal ventricular fibrillation type 2. Belongs to the peptidase S9B family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Protease. Cellular Component: cell soma; cell surface; integral to membrane; membrane; plasma membrane; voltage-gated potassium channel complex. Molecular Function: dipeptidyl-peptidase activity; potassium channel regulator activity; protein binding; serine-type peptidase activity. Biological Process: generation of action potential; positive regulation of potassium ion transport; proteolysis; regulation of membrane potential; regulation of potassium ion transport

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750