product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Cathelicidin antimicrobial peptide (CAMP)
catalog :
MBS950563
quantity :
1 mg (E Coli Derived
price :
1375 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS950563
products type :
Recombinant Protein
products full name :
Recombinant Human Cathelicidin antimicrobial peptide (CAMP)
products short name :
Cathelicidin antimicrobial peptide (CAMP)
products name syn :
Storage Buffer PBS pH 7.4, 50% glycerol
other names :
cathelicidin antimicrobial peptide preproprotein; Cathelicidin antimicrobial peptide; cathelicidin antimicrobial peptide; 18 kDa cationic antimicrobial protein; cathelicidin antimicrobial peptide; 18 kDa cationic antimicrobial protein; CAP-18; hCAP-18Cleaved into the following 2 chains:Antibacterial protein FALL-39; Alternative name(s):; FALL-39 peptide antibiotic
products gene name syn :
Recombinant Cathelicidin antimicrobial peptide (CAMP); Cathelicidin antimicrobial peptide; 18 kDa cationic antimicrobial protein; CAP-18; hCAP-18 Cleaved into the following 2 chains: 1. Antibacterial protein FALL-39; FALL-39 peptide antibiotic Antibacterial protein LL-37
other gene names :
CAMP; CAMP; LL37; CAP18; CRAMP; HSD26; CAP-18; FALL39; FALL-39; CAP18; FALL39; CAP-18; hCAP-18
uniprot entry name :
CAMP_HUMAN
host :
E Coli or Yeast
sequence positions :
134-170
sequence length :
173
sequence :
[LL-37, 37 aa]
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: GST tagged (Host tag may vary. Please inquire for specific tag information). Species: Homo sapiens (Human)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
CAMP; CAP18, FALL39; HSD26
ncbi gi num :
348041314
ncbi acc num :
NP_004336.3
ncbi gb acc num :
NM_004345.4
uniprot acc num :
P49913
ncbi mol weight :
19,301 Da
ncbi pathways :
Disease Pathway 530764!!Latent Infection Of Homo Sapiens With Mycobacterium Tuberculosis Pathway 645267!!Phagosomal Maturation (early Endosomal Stage) Pathway 645268!!Salivary Secretion Pathway 153376!!Salivary Secretion Pathway 153352!!Tuberculosis Pathway 213780!!Tuberculosis Pathway 213743
ncbi summary :
This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. The encoded protein has several functions in addition to antimicrobial activity, including cell chemotaxis, immune mediator induction and inflammatory response regulation. [provided by RefSeq, Aug 2011]
uniprot summary :
Function: Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. Ref.11 Ref.12. Subcellular location: Secreted. Tissue specificity: Expressed in bone marrow and testis and neutrophils. Post-translational modification: The N-terminus is blocked. Sequence similarities: Belongs to the cathelicidin family. Caution: Ref.8 sequence was incorrectly assigned to originate from M.mulatta.
size :
1 mg (E Coli Derived)
price :
1375 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!