product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Perforin-1
catalog :
MBS950325
quantity :
0.01 mg (E-Coli)
price :
235 USD
more info or order :
image
image 1 :
MyBioSource MBS950325 image 1
product information
catalog number :
MBS950325
products type :
Recombinant Protein
products full name :
Recombinant Mouse Perforin-1
products short name :
[Perforin-1]
products name syn :
[P1; Cytolysin; Lymphocyte pore-forming protein]
other names :
[perforin-1; Perforin-1; perforin-1; perforin 1 (pore forming protein); Cytolysin; Lymphocyte pore-forming protein]
products gene name :
[Prf1]
other gene names :
[Prf1; Prf1; Pfn; Pfp; Prf-1; Pfp; P1]
uniprot entry name :
PERF_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[21-554aa; Full Length of Mature Protein]
sequence length :
767
sequence :
PCYTATRSECKQKHKFVPGVWMAGEGMDVTTLRRSGSFP
VNTQRFLRPDRTCTLCKNSLMRDATQRLPVAITHWRPHS
SHCQRNVAAAKVHSTEGVAREAAANINNDWRVGLDVNPR
PEANMRASVAGSHSKVANFAAEKTYQDQYNFNSDTVECR
MYSFRLVQKPPLHLDFKKALRALPRNFNSSTEHAYHRLI
SSYGTHFITAVDLGGRISVLTALRTCQLTLNGLTADEVG
DCLNVEAQVSIGAQASVSSEYKACEEKKKQHKMATSFHQ
TYRERHVEVLGGPLDSTHDLLFGNQATPEQFSTWTASLP
SNPGLVDYSLEPLHTLLEEQNPKREALRQAISHYIMSRA
RWQNCSRPCRSGQHKSSHDSCQCECQDSKVTNQDCCPRQ
RGLAHLVVSNFRAEHLWGDYTTATDAYLKVFFGGQEFRT
GVVWNNNNPRWTDKMDFENVLLSTGGPLRVQVWDADYGW
DDDLLGSCDRSPHSGFHEVTCELNHGRVKFSYHAKCLPH
LTGGTCLEYAPQGLLGDPPGNRSGAVW
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-PAGE
other info2 :
Species: Mus musculus (Mouse) . Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Immunology
products description :
Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.
products references :
The molecular basis for perforin oligomerization and transmembrane pore assembly." Baran K., Dunstone M., Chia J., Ciccone A., Browne K.A., Clarke C.J.P., Lukoyanova N., Saibil H., Whisstock J.C., Voskoboinik I., Trapani J.A. Immunity 30:684-695(2009)
ncbi gi num :
225735600
ncbi acc num :
NP_035203.3
ncbi gb acc num :
NM_011073.3
uniprot acc num :
P10820
ncbi mol weight :
63.98kD
ncbi pathways :
Allograft Rejection Pathway (83316); Allograft Rejection Pathway (535); Apoptosis Pathway (198339); Autoimmune Thyroid Disease Pathway (83314); Autoimmune Thyroid Disease Pathway (533); Graft-versus-host Disease Pathway (83317); Graft-versus-host Disease Pathway (536); Natural Killer Cell Mediated Cytotoxicity Pathway (83276); Natural Killer Cell Mediated Cytotoxicity Pathway (490); Type I Diabetes Mellitus Pathway (83292)
uniprot summary :
PRF1: Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune system, e.g. in transplant rejection or some forms of autoimmune disease. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes. Monomer, as sobluble protein. Homooligomer. Oligomerization is required for pore formation. Repressed by contact with target cells. Belongs to the complement C6/C7/C8/C9 family. Protein type: Membrane protein, multi-pass. Cellular Component: cytoplasmic membrane-bound vesicle; cytoplasmic vesicle; endosome; extracellular region; extracellular space; integral to membrane; membrane; plasma membrane. Molecular Function: calcium ion binding; metal ion binding; wide pore channel activity. Biological Process: apoptosis; circadian rhythm; cytolysis; defense response to tumor cell; defense response to virus; formation of immunological synapse; immune response to tumor cell; protein homooligomerization; transmembrane transport
size1 :
0.01 mg (E-Coli)
price1 :
235 USD
size2 :
0.05 mg (E-Coli)
price2 :
320
size3 :
0.1 mg (E-Coli)
price3 :
535
size4 :
0.2 mg (E-Coli)
price4 :
855
size5 :
0.5 mg (E-Coli)
price5 :
1125
size6 :
1 mg (E-Coli)
price6 :
1725
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!