catalog number :
MBS950325
products type :
Recombinant Protein
products full name :
Recombinant Mouse Perforin-1
products short name :
[Perforin-1]
products name syn :
[P1; Cytolysin; Lymphocyte pore-forming protein]
other names :
[perforin-1; Perforin-1; perforin-1; perforin 1 (pore forming protein); Cytolysin; Lymphocyte pore-forming protein]
products gene name :
[Prf1]
other gene names :
[Prf1; Prf1; Pfn; Pfp; Prf-1; Pfp; P1]
uniprot entry name :
PERF_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[21-554aa; Full Length of Mature Protein]
sequence :
PCYTATRSECKQKHKFVPGVWMAGEGMDVTTLRRSGSFP
VNTQRFLRPDRTCTLCKNSLMRDATQRLPVAITHWRPHS
SHCQRNVAAAKVHSTEGVAREAAANINNDWRVGLDVNPR
PEANMRASVAGSHSKVANFAAEKTYQDQYNFNSDTVECR
MYSFRLVQKPPLHLDFKKALRALPRNFNSSTEHAYHRLI
SSYGTHFITAVDLGGRISVLTALRTCQLTLNGLTADEVG
DCLNVEAQVSIGAQASVSSEYKACEEKKKQHKMATSFHQ
TYRERHVEVLGGPLDSTHDLLFGNQATPEQFSTWTASLP
SNPGLVDYSLEPLHTLLEEQNPKREALRQAISHYIMSRA
RWQNCSRPCRSGQHKSSHDSCQCECQDSKVTNQDCCPRQ
RGLAHLVVSNFRAEHLWGDYTTATDAYLKVFFGGQEFRT
GVVWNNNNPRWTDKMDFENVLLSTGGPLRVQVWDADYGW
DDDLLGSCDRSPHSGFHEVTCELNHGRVKFSYHAKCLPH
LTGGTCLEYAPQGLLGDPPGNRSGAVW
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-PAGE
other info2 :
Species: Mus musculus (Mouse) . Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Immunology
products description :
Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.
products references :
The molecular basis for perforin oligomerization and transmembrane pore assembly."
Baran K., Dunstone M., Chia J., Ciccone A., Browne K.A., Clarke C.J.P., Lukoyanova N., Saibil H., Whisstock J.C., Voskoboinik I., Trapani J.A.
Immunity 30:684-695(2009)
ncbi acc num :
NP_035203.3
ncbi gb acc num :
NM_011073.3
ncbi mol weight :
63.98kD
ncbi pathways :
Allograft Rejection Pathway (83316); Allograft Rejection Pathway (535); Apoptosis Pathway (198339); Autoimmune Thyroid Disease Pathway (83314); Autoimmune Thyroid Disease Pathway (533); Graft-versus-host Disease Pathway (83317); Graft-versus-host Disease Pathway (536); Natural Killer Cell Mediated Cytotoxicity Pathway (83276); Natural Killer Cell Mediated Cytotoxicity Pathway (490); Type I Diabetes Mellitus Pathway (83292)
uniprot summary :
PRF1: Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune system, e.g. in transplant rejection or some forms of autoimmune disease. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes. Monomer, as sobluble protein. Homooligomer. Oligomerization is required for pore formation. Repressed by contact with target cells. Belongs to the complement C6/C7/C8/C9 family. Protein type: Membrane protein, multi-pass. Cellular Component: cytoplasmic membrane-bound vesicle; cytoplasmic vesicle; endosome; extracellular region; extracellular space; integral to membrane; membrane; plasma membrane. Molecular Function: calcium ion binding; metal ion binding; wide pore channel activity. Biological Process: apoptosis; circadian rhythm; cytolysis; defense response to tumor cell; defense response to virus; formation of immunological synapse; immune response to tumor cell; protein homooligomerization; transmembrane transport