Recombinant Human Transforming growth factor beta-3 | MyBioSource MBS950272 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Transforming growth factor beta-3

catalog :

MBS950272

quantity :

0.01 mg (E-Coli)

price :

110 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS950272

products type :

Recombinant Protein

products full name :

Recombinant Human Transforming growth factor beta-3

products short name :

Transforming growth factor beta-3

products name syn :

Cleaved into the following chain: Latency-associated peptide; LAP

other names :

transforming growth factor beta-3 preproprotein; Transforming growth factor beta-3; transforming growth factor beta-3; transforming growth factor beta 3

products gene name :

TGFB3

other gene names :

TGFB3; TGFB3; ARVD; RNHF; ARVD1; TGF-beta3; TGF-beta-3; LAP

uniprot entry name :

TGFB3_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

24-300

sequence length :

309

sequence :

LSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVM
THVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYY
AKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVE
KNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEH
IAKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESN
LGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVDNED
DHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQ
RKKR

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Homo sapiens (Human)

products categories :

Cancer

products description :

Involved in embryogenesis and cell differentiation.

products references :

Identification of another member of the transforming growth factor type beta gene family." ten Dijke P., Hansen P., Iwata K., Pieler C., Foulkes J.G. Proc. Natl. Acad. Sci. U.S.A. 85:4715-4719(1988)

ncbi gi num :

4507465

ncbi acc num :

NP_003230.1

ncbi gb acc num :

NM_003239.3

uniprot acc num :

P10600

ncbi mol weight :

48.07kD

ncbi pathways :

AGE-RAGE Signaling Pathway In Diabetic Complications (1319988); AGE-RAGE Signaling Pathway In Diabetic Complications (1319775); ALK1 Signaling Events Pathway (137968); Amoebiasis Pathway (167324); Amoebiasis Pathway (167191); Cell Cycle Pathway (83054); Cell Cycle Pathway (463); Chagas Disease (American Trypanosomiasis) Pathway (147809); Chagas Disease (American Trypanosomiasis) Pathway (147795); Chronic Myeloid Leukemia Pathway (83116)

ncbi summary :

This gene encodes a member of the TGF-beta family of proteins. The encoded protein is secreted and is involved in embryogenesis and cell differentiation. Defects in this gene are a cause of familial arrhythmogenic right ventricular dysplasia 1. [provided by RefSeq, Mar 2009]

uniprot summary :

TGFB3: Involved in embryogenesis and cell differentiation. Homodimer; disulfide-linked. Interacts with ASPN. Belongs to the TGF-beta family. Protein type: Secreted; Secreted, signal peptide; Ligand, receptor tyrosine kinase; Cell development/differentiation; Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 14q24. Cellular Component: cell soma; cell surface; extracellular matrix; extracellular region; extracellular space; nucleus; plasma membrane; proteinaceous extracellular matrix; T-tubule. Molecular Function: cytokine activity; growth factor activity; identical protein binding; protein binding; protein heterodimerization activity; punt binding; transforming growth factor beta binding. Biological Process: activation of MAPK activity; aging; alveolus development; blood coagulation; cell development; cell growth; embryonic neurocranium morphogenesis; extracellular matrix organization and biogenesis; female pregnancy; gut development; in utero embryonic development; inner ear development; intercellular junction assembly and maintenance; mammary gland development; negative regulation of cell proliferation; negative regulation of DNA replication; negative regulation of neuron apoptosis; negative regulation of transforming growth factor beta receptor signaling pathway; odontogenesis; palate development; platelet activation; platelet degranulation; positive regulation of apoptosis; positive regulation of bone mineralization; positive regulation of cell division; positive regulation of collagen biosynthetic process; positive regulation of DNA replication; positive regulation of filopodium formation; positive regulation of protein secretion; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of apoptosis; regulation of cell proliferation; regulation of MAPKKK cascade; response to estrogen stimulus; response to hypoxia; response to progesterone stimulus; salivary gland morphogenesis; SMAD protein nuclear translocation; transforming growth factor beta receptor signaling pathway; uterine wall breakdown. Disease: Arrhythmogenic Right Ventricular Dysplasia, Familial, 1; Rienhoff Syndrome

size1 :

0.01 mg (E-Coli)

price1 :

110 USD

size2 :

0.05 mg (E-Coli)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.5 mg (E-Coli)

price4 :

750

size5 :

0.05 mg (Baculovirus)

price5 :

1030

more info or order :

MyBioSource product webpage