catalog number :
MBS950251
products type :
Recombinant Protein
products full name :
Recombinant Human ATP synthase subunit O, mitochondrial (ATP5O)
products short name :
[ATP synthase subunit O, mitochondrial (ATP5O)]
other names :
[ATP synthase subunit O, mitochondrial; ATP synthase subunit O, mitochondrial; ATP synthase subunit O, mitochondrial; ATP synthase peripheral stalk subunit OSCP; Oligomycin sensitivity conferral protein; OSCP]
products gene name :
[ATP5O]
other gene names :
[ATP5PO; ATP5O; ATPO; OSCP; ATP5O; HMC08D05; ATPO; OSCP]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[24-213aa. Full Length of Mature Protein]
sequence :
FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKEL
LRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERF
SPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVP
CTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDP
SILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Human
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol
products description :
This protein is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance.
ncbi acc num :
NP_001688.1
ncbi gb acc num :
NM_001697.2
ncbi mol weight :
23,277 Da
ncbi pathways :
Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Electron Transport Chain Pathway (198860); F-type ATPase, Eukaryotes Pathway (522535); F-type ATPase, Eukaryotes Pathway (890450); Formation Of ATP By Chemiosmotic Coupling Pathway (105922); Huntington's Disease Pathway (83100); Huntington's Disease Pathway (512); Metabolic Pathways (132956); Metabolism Pathway (477135)
ncbi summary :
The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. [provided by RefSeq, Jul 2008]
uniprot summary :
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.
size7 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size12 :
0.1 mg (Baculovirus)
size14 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)