Recombinant Mouse Interferon regulatory factor 8 | MyBioSource MBS950244 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Interferon regulatory factor 8

catalog :

MBS950244

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS950244

products type :

Recombinant Protein

products full name :

Recombinant Mouse Interferon regulatory factor 8

products short name :

Interferon regulatory factor 8

products name syn :

Interferon consensus sequence-binding protein; ICSBP

other names :

interferon regulatory factor 8; Interferon regulatory factor 8; interferon regulatory factor 8; interferon regulatory factor 8; Interferon consensus sequence-binding protein; ICSBP

products gene name :

Irf8

other gene names :

Irf8; Irf8; Myls; ICSBP; IRF-8; Icsbp1; AI893568; Icsbp; Icsbp1; IRF-8; ICSBP

uniprot entry name :

IRF8_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-424

sequence length :

424

sequence :

MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKTMFRIP
WKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATW
KTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEE
QKCKLGVAPAGCMSEVPEMECGRSEIEELIKEPSVDEYM
GMTKRSPSPPEACRSQILPDWWVQQPSAGLPLVTGYAAY
DTHHSAFSQMVISFYYGGKLVGQATTTCLEGCRLSLSQP
GLPKLYGPDGLEPVCFPTADT

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Plays a regulatory role in cells of the immune system. Involved in CD8+ dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes.

products references :

An interferon gamma-regulated protein that binds the interferon-inducible enhancer element of major histocompatibility complex class I genes.Driggers P.H., Ennist D.L., Gleason S.L., Mak W.-H., Marks M.S., Levi B.-Z., Flanagan J.R., Appella E., Ozato K.Proc. Natl. Acad. Sci. U.S.A. 87:3743-3747(1990) Autoantigen Ro52 is an interferon inducible E3 ligase that ubiquitinates IRF-8 and enhances cytokine expression in macrophages.Kong H.J., Anderson D.E., Lee C.H., Jang M.K., Tamura T., Tailor P., Cho H.K., Cheong J., Xiong H., Morse H.C. III, Ozato K.J. Immunol. 179:26-30(2007) Compensatory dendritic cell development mediated by BATF-IRF interactions.Tussiwand R., Lee W.L., Murphy T.L., Mashayekhi M., Kc W., Albring J.C., Satpathy A.T., Rotondo J.A., Edelson B.T., Kretzer N.M., Wu X., Weiss L.A., Glasmacher E., Li P., Liao W., Behnke M., Lam S.S., Aurthur C.T., Leonard W.J., Singh H., Stallings C.L., Sibley L.D., Schreiber R.D., Murphy K.M.Nature 490:502-507(2012)

ncbi gi num :

685424584

ncbi acc num :

NP_001288740.1

ncbi gb acc num :

NM_001301811.1

uniprot acc num :

P23611

ncbi mol weight :

64.21kD

ncbi pathways :

Pertussis Pathway (218112); Pertussis Pathway (218099); Type II Interferon Signaling (IFNG) Pathway (198408)

ncbi summary :

The protein encoded by this gene is a transcription factor that belongs to the interferon regulatory factor family. Proteins belonging to this family have a DNA binding domain at the amino terminus that contains five well-conserved tryptophan-rich repeats. This domain recognizes DNA sequences similar to the interferon-stimulated response element. The protein encoded by this gene promotes or suppresses lineage-specific genes to regulate the differentation of lymphoid and myeloid lineage cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014]

uniprot summary :

IRF8: Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Plays a negative regulatory role in cells of the immune system. Interacts (via C-terminus) with TRIM21 (via C-terminus). Interacts with COPS2. By IFNG/IFN-gamma. Predominantly expressed in lymphoid tissues. Belongs to the IRF family. Protein type: DNA-binding; Transcription factor. Cellular Component: nucleoplasm; nucleus. Molecular Function: DNA binding; protein binding; transcription factor activity. Biological Process: defense response to bacterium; defense response to protozoan; immune response; myeloid cell differentiation; phagocytosis; positive regulation of interferon-gamma production; positive regulation of interleukin-12 production; positive regulation of transcription, DNA-dependent; regulation of transcription, DNA-dependent; response to bacterium; transcription, DNA-dependent

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

size5 :

0.05 mg (Baculovirus)

price5 :

1200

more info or order :

MyBioSource product webpage