Recombinant Mouse Integrin beta-1 | MyBioSource MBS950143 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Integrin beta-1

catalog :

MBS950143

quantity :

0.01 mg (E-Coli)

price :

110 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS950143

products type :

Recombinant Protein

products full name :

Recombinant Mouse Integrin beta-1

products short name :

Integrin beta-1

products name syn :

Fibronectin receptor subunit beta; VLA-4 subunit beta; CD_antigen: CD29

other names :

integrin beta-1; Integrin beta-1; integrin beta-1; integrin beta 1 (fibronectin receptor beta); Fibronectin receptor subunit beta; VLA-4 subunit beta; CD_antigen: CD29

products gene name :

Itgb1

other gene names :

Itgb1; Itgb1; CD29; Fnrb; gpIIa; Gm9863; AA409975; AA960159; 4633401G24Rik; ENSMUSG00000051907

uniprot entry name :

ITB1_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

21-728

sequence length :

801

sequence :

QTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMP
TSARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNR
SKGMAEKLRPEDITQIQPQQLLLKLRSGEPQKFTLKFKR
AEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRI
TSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTS
PFSYKNVLSLTDRGEFFNELVGQQRISGNLDSPEGGFDA
IMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGI
VLPNDGQCHLENNVYTMSHYYDYPSIAHLVQKLSENNIQ
TIFAVTEEFQPVYKELKNLIPKSAVGTLSGNSSNVIQLI
IDAYNSLSSEVILENSKLPDGVTINYKSYCKNGVNGTGE
NGRKCSNISIGDEVQFEISITANKCPNKESETIKIKPLG
FTEEVEVVLQFICKCNCQSHGIPASPKCHEGNGTFECGA
CRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSN
NGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGL
ICGGNGVCRCRVCECYPNYTGSACDCSLDTGPCLASNGQ
ICNGRGICECGACKCTDPKFQGPTCETCQTCLGVCAEHK
ECVQCRAFNKGEKKDTCAQECSHFNLTKVESREKLPQPV
QVDPVTHCKEKDIDDCWFYFTYSVNGNNEAIVHVVETPD
CPTGPD

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Mus musculus (Mouse)

products categories :

Signal Transduction

products description :

Integrins alpha-1/beta-1, alpha-2/beta-1, alpha-10/beta-1 and alpha-11/beta-1 are receptors for collagen. Integrins alpha-1/beta-1 and alpha-2/beta-2 recognize the proline-hydroxylated sequence G-F-P-G-E-R in collagen. Integrins alpha-2/beta-1, alpha-3/beta-1, alpha-4/beta-1, alpha-5/beta-1, alpha-8/beta-1, alpha-10/beta-1, alpha-11/beta-1 and alpha-V/beta-1 are receptors for fibronectin. Alpha-4/beta-1 recognizes one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. Integrin alpha-5/beta-1 is a receptor for fibrinogen. Integrin alpha-1/beta-1, alpha-2/beta-1, alpha-6/beta-1 and alpha-7/beta-1 are receptors for lamimin. Integrin alpha-4/beta-1 is a receptor for VCAM1 and recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-9/beta-1 is a receptor for VCAM1, cytotactin and osteopontin. It recognizes the sequence A-E-I-D-G-I-E-L in cytotactin. Integrin alpha-3/beta-1 is a receptor for epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration. Integrin alpha-V/beta-1 is a receptor for vitronectin. Beta-1 integrins recognize the sequence R-G-D in a wide array of ligands. When associated with alpha-7/beta-1 integrin, regulates cell adhesion and laminin matrix deposition. Involved in promoting endothelial cell motility and angiogenesis. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process and the formation of mineralized bone nodules. May be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and GNB2L1, serves as a platform for SRC activation or inactivation. Plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis.

products references :

Murine mRNA for the beta-subunit of integrin is increased in BALB/c-3T3 cells entering the G1 phase from the G0 state." Tominaga S. FEBS Lett. 238:315-319(1988)

ncbi gi num :

45504394

ncbi acc num :

NP_034708.1

ncbi gb acc num :

NM_010578.2

uniprot acc num :

P09055

ncbi mol weight :

82.26kD

ncbi pathways :

Adaptive Immune System Pathway (1323640); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (117303); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (116129); Axon Guidance Pathway (83262); Axon Guidance Pathway (476); Axon Guidance Pathway (1323598); Bacterial Invasion Of Epithelial Cells Pathway (149817); Bacterial Invasion Of Epithelial Cells Pathway (148661); Basigin Interactions Pathway (1323594); Cell Adhesion Molecules (CAMs) Pathway (83266)

uniprot summary :

ITGB1: an integral membrane protein that heterodimerizes with an alpha-3 chain, forming a receptor for many extracellular-matrix proteins including fibronectin, laminin, collagen, epiligrin and thrombospondin. Beta 1 integrins recognize the amino-acid motif RGD in a wide array of ligands. Five alternatively spliced variants with alternate carboxy termini have been described. Two alternatively spliced isoforms have been described. Isoform beta-1a is widely expressed; other isoforms are generally expressed with a more restricted distribution. Isoform beta-1b is expressed in skin, liver, skeletal muscle, cardiac muscle, placenta, umbilical vein endothelial cells, neuroblastoma cells, lymphoma cells, hepatoma cells and astrocytoma cells. Isoforms beta-1c and beta-1c-2 are expressed in muscle, kidney, liver, placenta, cervical epithelium, umbilical vein endothelial cells, fibroblast cells, embryonal kidney cells, platelets and several blood cell lines. Isoform beta-c-2, rather than isoform beta-1c, is selectively expressed in primary t-cells. Isoform beta-1c is expressed in nonproliferating and differentiated prostate gland epithelial cells. Isoform beta-1d is expressed specifically in striated muscle (skeletal and cardiac muscle). Protein type: Cell adhesion; Membrane protein, integral; Motility/polarity/chemotaxis; Receptor, misc.; Cell surface. Cellular Component: acrosome; adherens junction; basement membrane; cell junction; cell projection; cell surface; cytoplasm; cytoplasmic vesicle; dendritic spine; endosome; external side of plasma membrane; filopodium; focal adhesion; hemidesmosome; integral to membrane; integrin complex; intercellular junction; lipid raft; membrane; neuromuscular junction; perinuclear region of cytoplasm; plasma membrane; receptor complex; sarcolemma; synapse. Molecular Function: actin binding; alpha-actinin binding; cell adhesion molecule binding; collagen binding; fibronectin binding; glycoprotein binding; integrin binding; kinase binding; laminin binding; metal ion binding; peptide binding; protease binding; protein binding; protein complex binding; protein domain specific binding; protein heterodimerization activity; protein kinase binding; receptor activity; receptor binding. Biological Process: axon extension; calcium-independent cell-matrix adhesion; cardiac muscle cell differentiation; cardiac muscle development; cell adhesion; cell fate specification; cell migration; cell migration during sprouting angiogenesis; cell-matrix adhesion; cell-substrate adhesion; cellular calcium ion homeostasis; dendrite morphogenesis; formation of radial glial scaffolds; G1/S transition of mitotic cell cycle; germ cell migration; heterotypic cell-cell adhesion; in utero embryonic development; integrin-mediated signaling pathway; leukocyte adhesion; leukocyte tethering or rolling; negative regulation of cell differentiation; negative regulation of cell projection organization and biogenesis; negative regulation of cell proliferation; negative regulation of neuron differentiation; negative regulation of Rho protein signal transduction; neurite development; positive regulation of apoptosis; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of endocytosis; positive regulation of GTPase activity; positive regulation of MAPKKK cascade; positive regulation of neuron differentiation; positive regulation of peptidyl-tyrosine phosphorylation; protein transport within lipid bilayer; receptor internalization; regulation of cell cycle; regulation of G-protein coupled receptor protein signaling pathway; sarcomere organization; stress fiber formation; tissue homeostasis; transforming growth factor beta receptor signaling pathway; visual learning

size1 :

0.01 mg (E-Coli)

price1 :

110 USD

size2 :

0.05 mg (E-Coli)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.5 mg (E-Coli)

price4 :

750

size5 :

1 mg (E-Coli)

price5 :

1180

more info or order :

MyBioSource product webpage