catalog number :
MBS950116
products type :
Recombinant Protein
products full name :
Recombinant Bovine Apolipoprotein A-I
products short name :
Apolipoprotein A-I
products name syn :
Apolipoprotein A1
other names :
apolipoprotein A-I preproprotein; Apolipoprotein A-I; apolipoprotein A-I; Apolipoprotein A1
products gene name :
APOA1
other gene names :
APOA1; APOA1; Apo-AI; ApoA-I; ProapoA-I
uniprot entry name :
APOA1_BOVIN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
25-265
sequence :
DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGK
QLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKET
ASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQK
VAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVE
TLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKAS
EQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEA
SKKLNAQ
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.
products references :
Cloning and sequencing of bovine apolipoprotein A-I cDNA and molecular evolution of apolipoproteins A-I and B-100.O'Huigin C., Chan L., Li W.H.Mol. Biol. Evol. 7:327-339(1990)
NIH - Mammalian Gene Collection (MGC)
project
Plasma lipid transport in the preruminant calf, Bos spp
primary structure of bovine apolipoprotein A-I.Sparrow D.A., Lee B.R., Laplaud M.P., Auboiron S., Bauchart D., Chapman J.M., Gotto A.M. Jr., Yang C.Y., Sparrow J.T.Biochim. Biophys. Acta 1123:145-150(1992)
Characterization and amino-terminal sequence of apolipoprotein AI from plasma high density lipoproteins in the preruminant calf, Bos spp.Auboiron S., Sparrow D.A., Beaubatie L., Bauchart D., Sparrow J.T., Laplaud M.P., Chapman J.M.Biochem. Biophys. Res. Commun. 166:833-839(1990)
ncbi acc num :
NP_776667.2
ncbi gb acc num :
NM_174242.3
ncbi pathways :
ABC Transporters In Lipid Homeostasis Pathway (1332258); ABC-family Proteins Mediated Transport Pathway (1332257); African Trypanosomiasis Pathway (194381); African Trypanosomiasis Pathway (194323); Binding And Uptake Of Ligands By Scavenger Receptors Pathway (1332360); Chylomicron-mediated Lipid Transport Pathway (1331847); Fat Digestion And Absorption Pathway (194380); Fat Digestion And Absorption Pathway (194324); HDL-mediated Lipid Transport Pathway (1331848); Hemostasis Pathway (1332692)
size4 :
0.05 mg (Baculovirus)