product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Protein S100-A10 (S100A10)
catalog :
MBS950103
quantity :
1 mg (E-Coli)
price :
1135 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS950103
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Protein S100-A10 (S100A10)
products short name :
(Rhesus macaque) Protein S100-A10 (S100A10)
other names :
protein S100-A10; Protein S100-A10; protein S100-A10; calpactin I light chain; calpactin-1 light chain; S100 calcium-binding protein A10; Calpactin I light chain; Calpactin-1 light chain; S100 calcium-binding protein A10
products gene name syn :
Recombinant (Rhesus macaque) Protein S100-A10 (S100A10); Protein S100-A10; Calpactin I light chain Calpactin-1 light chain S100 calcium-binding protein A10
other gene names :
S100A10; S100A10; CAL1L
uniprot entry name :
S10AA_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
Feb-97
sequence length :
97
sequence :
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFP
GFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGL
TIACNDYFVVHMKQKGKK
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
products description :
S100A10; CAL1L
ncbi gi num :
74136457
ncbi acc num :
NP_001028124.1
ncbi gb acc num :
NM_001032952.2
uniprot acc num :
P62504
ncbi mol weight :
11,203 Da
uniprot summary :
Abi-2: May act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA. Belongs to the ABI family. 4 isoforms of the human protein are produced by alternative splicing. Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis. Cellular Component: cell projection; cell-cell adherens junction; cytoskeleton; lamellipodium; dendrite; cytoplasm; cytosol; filopodium. Molecular Function: ubiquitin protein ligase binding; protein complex binding; Rac GTPase binding; SH3 domain binding. Biological Process: cell migration; peptidyl-tyrosine phosphorylation; camera-type eye development; learning and/or memory; actin polymerization and/or depolymerization; dendrite development; Rac protein signal transduction; cell motility
size1 :
1 mg (E-Coli)
price1 :
1135 USD
size2 :
1 mg (Yeast)
price2 :
1595
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!