Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 5 | MyBioSource MBS950094 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 5

catalog :

MBS950094

quantity :

0.05 mg (E-Coli)

price :

305 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS950094

products type :

Recombinant Protein

products full name :

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 5

products short name :

Carcinoembryonic antigen-related cell adhesion molecule 5

products name syn :

Carcinoembryonic antigen; CEA; Meconium antigen 100; CD66e

other names :

carcinoembryonic antigen-related cell adhesion molecule 5 isoform 1 preproprotein; Carcinoembryonic antigen-related cell adhesion molecule 5; carcinoembryonic antigen-related cell adhesion molecule 5; carcinoembryonic antigen related cell adhesion molecule 5; Carcinoembryonic antigen; CEA; Meconium antigen 100; CD_antigen: CD66e

products gene name :

CEACAM5

other gene names :

CEACAM5; CEACAM5; CEA; CD66e; CEA; CEA

uniprot entry name :

CEAM5_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

35-685; Mature full length protein

sequence length :

685

sequence :

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERV
DGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNI
IQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISS
NNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPR
LQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSV
ILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQ
YSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTG
LNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCE
PEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTR
NDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSY
TYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELF
ISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPK
PSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSL
PVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSAN
RSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSAS
NPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVS
NLATGRNNSIVKSITVSASGTSPGLSA

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Tags & Cell Markers

products description :

Cell surface glycoprotein that plays a role in cell adhesion and in intracellular signaling. Receptor for E Coli Dr adhesins.

products references :

Isolation and characterization of full-length functional cDNA clones for human carcinoembryonic antigen.Beauchemin N., Benchimol S., Cournoyer D., Fuks A., Stanners C.P.Mol. Cell. Biol. 7:3221-3230(1987) Carcinoembryonic antigen family characterization of cDNAs coding for NCA and CEA and suggestion of nonrandom sequence variation in their conserved loop-domains.Barnett T., Goebel S.J., Nothdurft M.A., Elting J.J.Genomics 3:59-66(1988) Cloning of the complete gene for carcinoembryonic antigen analysis of its promoter indicates a region conveying cell type-specific expression.Schrewe H., Thompson J., Bona M., Hefta L.J.F., Maruya A., Hassauer M., Shively J.E., von Kleist S., Zimmermann W.Mol. Cell. Biol. 10:2738-2748(1990) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004) Primary structure of human carcinoembryonic antigen (CEA) deduced from cDNA sequence.Oikawa S., Nakazato H., Kosaki G.Biochem. Biophys. Res. Commun. 142:511-518(1987) Isolation and characterization of cDNA clones encoding the human carcinoembryonic antigen reveal a highly conserved repeating structure.Zimmermann W., Ortlieb B., Friedrich R., von Kleist S.Proc. Natl. Acad. Sci. U.S.A. 84:2960-2964(1987) Self recognition in the Ig superfamily. Identification of precise subdomains in carcinoembryonic antigen required for intercellular adhesion.Taheri M., Saragovi U., Fuks A., Makkerh J., Mort J., Stanners C.P.J. Biol. Chem. 275:26935-26943(2000) Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T., Loo J.A.J. Proteome Res. 5:1493-1503(2006) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Structural models for carcinoembryonic antigen and its complex with the single-chain Fv antibody molecule MFE23.Boehm M.K., Perkins S.J.FEBS Lett. 475:11-16(2000) Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation.Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S.Mol. Microbiol. 67:420-434(2008)

ncbi gi num :

612407802

ncbi acc num :

NP_001278413.1

ncbi gb acc num :

NM_001291484.2

uniprot acc num :

P06731

ncbi mol weight :

73.33kD

ncbi summary :

This gene encodes a cell surface glycoprotein that represents the founding member of the carcinoembryonic antigen (CEA) family of proteins. The encoded protein is used as a clinical biomarker for gastrointestinal cancers and may promote tumor development through its role as a cell adhesion molecule. Additionally, the encoded protein may regulate differentiation, apoptosis, and cell polarity. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]

uniprot summary :

CEACAM5: Cell surface glycoprotein that plays a role in cell adhesion and in intracellular signaling. Receptor for E.coli Dr adhesins. Homodimer. Binding of E.coli Dr adhesins leads to dissociation of the homodimer. Found in adenocarcinomas of endodermally derived digestive system epithelium and fetal colon. Belongs to the immunoglobulin superfamily. CEA family. Protein type: Membrane protein, GPI anchor; Membrane protein, integral; Immunoglobulin superfamily. Chromosomal Location of Human Ortholog: 19q13.1-q13.2. Cellular Component: basolateral plasma membrane; integral to plasma membrane. Molecular Function: identical protein binding; protein homodimerization activity. Biological Process: homotypic cell-cell adhesion; negative regulation of apoptosis

size1 :

0.05 mg (E-Coli)

price1 :

305 USD

size2 :

0.2 mg (E-Coli)

price2 :

580

size3 :

0.5 mg (E-Coli)

price3 :

950

size4 :

1 mg (E-Coli)

price4 :

1390

size5 :

0.05 mg (Baculovirus)

price5 :

1450

more info or order :

MyBioSource product webpage