product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Plasminogen (PLG)
catalog :
MBS950062
quantity :
1 mg (E-Coli)
price :
1445 USD
more info or order :
product information
catalog number :
MBS950062
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Plasminogen (PLG)
products short name :
(Rhesus macaque) Plasminogen (PLG)
products name syn :
Recombinant (Rhesus macaque) Plasminogen (PLG); Plasminogen EC= 3.4.21.7 Cleaved into the following 4 chains: 1. Plasmin heavy chain A 2. Activation peptide 3. Plasmin heavy chain A, short form 4. Plasmin light chain B
other names :
plasminogen; Plasminogen; plasminogen
products gene name syn :
PLG
other gene names :
PLG; PLG
uniprot entry name :
PLMN_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
581-810
sequence length :
810
sequence :
VVGGCVAYPHSWPWQISLRTRLGMHFCGGTLISPEWVLT
AAHCLEKSSRPSFYKVILGAHREVHLEPHVQEIEVSKMF
SEPARADIALLKLSSPAIITDKVIPACLPSPNYVVADRT
ECFITGWGETQGTYGAGLLKEARLPVIENKVCNRYEFLN
GTVKTTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQ
GVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
112807252
ncbi acc num :
NP_001036540.1
ncbi gb acc num :
NM_001043075.1
uniprot acc num :
P12545
ncbi mol weight :
90,255 Da
ncbi pathways :
Complement And Coagulation Cascades Pathway (86743); Complement And Coagulation Cascades Pathway (484); Influenza A Pathway (217176); Influenza A Pathway (217150); Neuroactive Ligand-receptor Interaction Pathway (86723); Neuroactive Ligand-receptor Interaction Pathway (462); Staphylococcus Aureus Infection Pathway (172860); Staphylococcus Aureus Infection Pathway (171867)
uniprot summary :
Function: Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells . By similarity. Catalytic activity: Preferential cleavage: Lys- -Xaa > Arg- -Xaa; higher selectivity than trypsin. Converts fibrin into soluble products. Enzyme regulation: Converted into plasmin by plasminogen activators, both plasminogen and its activator being bound to fibrin. Activated with catalytic amounts of streptokinase. Subunit structure: Interacts with CSPG4 and AMOT. Interacts (via the Kringle domains) with HRG; the interaction tethers PLG to the cell surface and enhances its activation . By similarity. Subcellular location: Secreted . By similarity. Note: Locates to the cell surface where it is proteolytically cleaved to produce the active plasmin. Interaction with HRG tethers it to the cell surface . By similarity. Domain: Kringle domains mediate interaction with CSPG4 . By similarity. Post-translational modification: In the presence of the inhibitor, the activation involves only cleavage after Arg-580, yielding two chains held together by two disulfide bonds. In the absence of the inhibitor, the activation involves additionally the removal of the activation peptide . By similarity. Miscellaneous: Plasmin is inactivated by alpha-2-antiplasmin immediately after dissociation from the clot.In the presence of the inhibitor, the activation involves only cleavage after Arg-580, resulting in 2 chains held together by 2 disulfide bonds. Without the inhibitor, the activation involves also removal of the activation peptide. Sequence similarities: Belongs to the peptidase S1 family. Plasminogen subfamily.Contains 5 kringle domains.Contains 1 PAN domain.Contains 1 peptidase S1 domain.
size1 :
1 mg (E-Coli)
price1 :
1445 USD
size2 :
1 mg (Yeast)
price2 :
1900
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!