product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Protein Wnt-11 (Wnt11)
catalog :
MBS950059
quantity :
0.5 mg (E-Coli)
price :
1090 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS950059
products type :
Recombinant Protein
products full name :
Recombinant Mouse Protein Wnt-11 (Wnt11)
products short name :
Protein Wnt-11 (Wnt11)
products name syn :
Protein Wnt-11
other names :
protein Wnt-11 isoform a; Protein Wnt-11; protein Wnt-11; wingless-related MMTV integration site 11; wingless-type MMTV integration site family, member 11
products gene name :
Wnt11
products gene name syn :
Wnt11; Wnt-11
other gene names :
Wnt11; Wnt11; Wnt-11
uniprot entry name :
WNT11_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
25-354, Mature full length protein
sequence length :
354
sequence :
IKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCRSNL
ELMRTIVHAARGAMKACRRAFADMRWNCSSIELAPNYLL
DLERGTRESAFVYALSAATISHTIARACTSGDLPGCSCG
PVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLETKCKCHGVSGSCS
IRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHL
VPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDR
QCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWC
CYVTCRRCERTVERYVCK
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Mus musculus (Mouse)
products description :
Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.
ncbi gi num :
553727152
ncbi acc num :
NP_001272721.1
ncbi gb acc num :
NM_001285792.1
uniprot acc num :
P48615
ncbi mol weight :
39,135 Da
ncbi pathways :
Basal Cell Carcinoma Pathway (83306); Basal Cell Carcinoma Pathway (525); ESC Pluripotency Pathways (198374); HTLV-I Infection Pathway (373903); HTLV-I Infection Pathway (373889); Hedgehog Signaling Pathway (83260); Hedgehog Signaling Pathway (474); Melanogenesis Pathway (83289); Melanogenesis Pathway (504); Pathways In Cancer (83298)
uniprot summary :
WNT11: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. Belongs to the Wnt family. Protein type: Secreted, signal peptide; Secreted. Cellular Component: extracellular space; proteinaceous extracellular matrix; cytoplasm; extracellular region. Molecular Function: protein binding; frizzled binding; protein kinase activator activity; receptor binding. Biological Process: Wnt receptor signaling pathway; cell fate commitment; positive regulation of apoptosis; positive regulation of transcription, DNA-dependent; multicellular organismal development; Wnt receptor signaling pathway through beta-catenin; palate development; positive regulation of transforming growth factor-beta2 production; signal transduction; protein amino acid phosphorylation; bone mineralization; osteoblast differentiation; neuron differentiation; organ morphogenesis; cell-cell signaling; positive regulation of protein kinase activity; positive regulation of stress fiber formation; artery morphogenesis; negative regulation of cell growth; kidney development; negative regulation of transcription, DNA-dependent; negative regulation of cell migration; positive regulation of cell migration; negative regulation of apoptosis
size1 :
0.5 mg (E-Coli)
price1 :
1090 USD
size2 :
0.05 mg (Baculovirus)
price2 :
1090
size3 :
0.05 mg (Mammalian-Cell)
price3 :
1320
size4 :
0.5 mg (Yeast)
price4 :
1320
size5 :
1 mg (E-Coli)
price5 :
1700
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!