protein

Recombinant Human Gastrin-releasing peptide

MBS950021

0.01 mg (Yeast)

110 USD

Recombinant Protein

Recombinant Human Gastrin-releasing peptide

Gastrin-releasing peptide

GRP-10

gastrin-releasing peptide isoform 2; Gastrin-releasing peptide; gastrin-releasing peptide; gastrin releasing peptide; Neuromedin-CAlternative name(s):GRP-10

GRP

GRP; GRP; BN; GRP-10; proGRP; preproGRP; GRP

GRP_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

31-98

141

GTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQ
QLREYIRWEEAARNLLGLIEAKENRNHQP

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Signal Transduction

GRP stimulates gastrin release as well as other gastrointestinal hormones. Operates as a negative feedback regulating fear and established a causal relationship between GRP-receptor gene expression, long-term potentiation, and amygdala-dependent mory for fear.

Two prohormones for gastrin-releasing peptide are encoded by two mRNAs differing by 19 nucleotides.Spindel E.R., Zilberberg M.D., Habener J.F., Chin W.W.Proc. Natl. Acad. Sci. U.S.A. 83:19-23(1986)

60498997

NP_001012530.1

NM_001012512.2

P07492

35.1kD

Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); G Alpha (q) Signalling Events Pathway (1269578); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); Gastrin-CREB Signalling Pathway Via PKC And MAPK (1269592); Incretin Synthesis, Secretion, And Inactivation Pathway (1268750); Metabolism Of Proteins Pathway (1268677); Peptide Hormone Metabolism Pathway (1268746); Peptide Ligand-binding Receptors Pathway (1269546); Signal Transduction Pathway (1269379)

This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]

GRP: GRP stimulates gastrin release as well as other gastrointestinal hormones. Operates as a negative feedback regulating fear and established a causal relationship between GRP- receptor gene expression, long-term potentiation, and amygdala- dependent memory for fear. Belongs to the bombesin/neuromedin-B/ranatensin family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 18q21.1-q21.32. Cellular Component: extracellular region; extracellular space. Molecular Function: neuropeptide hormone activity; receptor binding. Biological Process: neuropeptide signaling pathway; signal transduction

0.01 mg (Yeast)

110 USD

0.05 mg (E-Coli)

190

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460