catalog number :
MBS949995
products type :
Recombinant Protein
products full name :
Recombinant Mouse Small ubiquitin-related modifier 2 (Sumo2)
products short name :
Small ubiquitin-related modifier 2 (Sumo2)
other names :
small ubiquitin-related modifier 2; Small ubiquitin-related modifier 2; small ubiquitin-related modifier 2; sentrin-2; SMT3 homolog 2; ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B; SMT3 supressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 2 (yeast); SMT3 homolog 2; Sentrin-2; Ubiquitin-like protein SMT3A
products gene name syn :
Recombinant Small ubiquitin-related modifier 2 (Sumo2); Small ubiquitin-related modifier 2; SUMO-2; SMT3 homolog 2 Sentrin-2 Ubiquitin-like protein SMT3A; Smt3A
other gene names :
Sumo2; Sumo2; Smt3A; Smt3b; SUMO-2; Smt3h2; Smt3a; Smt3h2; SUMO-2; Smt3A
uniprot entry name :
SUMO2_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
Jan-93
sequence :
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTP
LSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEM
EDEDTIDVFQQQTGG
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Mus musculus (Mouse)
products description :
Sumo2; Smt3a, Smt3h2
ncbi acc num :
NP_579932.1
ncbi gb acc num :
NM_133354.2
ncbi mol weight :
10,871 Da
ncbi pathways :
Nuclear Pore Complex Pathway (470423); RNA Transport Pathway (177887); RNA Transport Pathway (175229); Wnt Signaling Pathway NetPath (198351)
uniprot summary :
SUMO2: Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Homotrimer (Potential). Crystal packing analysis suggests a possible trimeric assembly, of which the biological significance remains to be determined. Interacts with SAE2 and UBE2I. Covalently attached to a number of proteins. Interacts with PELP1. Interacts with USP25; the interaction sumoylates USP25. Broadly expressed. Belongs to the ubiquitin family. SUMO subfamily. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Ubiquitin-like modifier. Cellular Component: PML body; nucleus. Molecular Function: ubiquitin protein ligase binding; SUMO ligase activity. Biological Process: protein sumoylation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent