product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Parathyroid hormone 2 receptor
catalog :
MBS949987
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS949987
products type :
Recombinant Protein
products full name :
Recombinant Human Parathyroid hormone 2 receptor
products short name :
Parathyroid hormone 2 receptor
other names :
parathyroid hormone 2 receptor isoform 2; Parathyroid hormone 2 receptor; parathyroid hormone 2 receptor; parathyroid hormone 2 receptor
products gene name :
PTH2R
other gene names :
PTH2R; PTH2R; PTHR2; PTHR2; PTH2 receptor
uniprot entry name :
PTH2R_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
27-145
sequence length :
550
sequence :
DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFP
EWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCN
PNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFER
LY
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Neuroscience
products description :
This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor.
products references :
Identification and functional expression of a receptor selectively recognizing parathyroid hormone, the PTH2 receptor.Usdin T.B., Gruber C., Bonner T.I.J. Biol. Chem. 270:15455-15458(1995) cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org) .King M.M., Aronstam R.S., Sharma S.V. Assignment of the human PTH2 receptor gene (PTHR2) to chromosome 2q33 by fluorescence in situ hybridization.Usdin T.B., Modi W., Bonner T.I.Genomics 37:140-141(1996) Identification and characterization of the murine and human gene encoding the tuberoinfundibular peptide of 39 residues.John M.R., Arai M., Rubin D.A., Jonsson K.B., Jueppner H.Endocrinology 143:1047-1057(2002)
ncbi gi num :
828747943
ncbi acc num :
NP_001296445.1
ncbi gb acc num :
NM_001309516.1
uniprot acc num :
P49190
ncbi mol weight :
29.6kD
ncbi pathways :
Class B/2 (Secretin Family Receptors) Pathway (1269570); G Alpha (s) Signalling Events Pathway (1269575); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); GPCRs, Class B Secretin-like Pathway (198781); Neuroactive Ligand-receptor Interaction Pathway (83053); Neuroactive Ligand-receptor Interaction Pathway (462); Signal Transduction Pathway (1269379); Signaling By GPCR Pathway (1269543)
ncbi summary :
The protein encoded by this gene is a member of the G-protein coupled receptor 2 family. This protein is a receptor for parathyroid hormone (PTH). This receptor is more selective in ligand recognition and has a more specific tissue distribution compared to parathyroid hormone receptor 1 (PTHR1). It is activated only by PTH and not by parathyroid hormone-like hormone (PTHLH) and is particularly abundant in brain and pancreas. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]
uniprot summary :
PTH2R: This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor. Belongs to the G-protein coupled receptor 2 family. Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, family 2; Membrane protein, multi-pass. Chromosomal Location of Human Ortholog: 2q33. Cellular Component: integral to plasma membrane; plasma membrane. Molecular Function: parathyroid hormone receptor activity; protein binding. Biological Process: cell surface receptor linked signal transduction; G-protein coupled receptor protein signaling pathway
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
size5 :
1 mg (Yeast)
price5 :
1835
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!