Recombinant Human C-X-C chemokine receptor type 2 | MyBioSource MBS949885 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human C-X-C chemokine receptor type 2

catalog :

MBS949885

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS949885

products type :

Recombinant Protein

products full name :

Recombinant Human C-X-C chemokine receptor type 2

products short name :

C-X-C chemokine receptor type 2

products name syn :

CDw128b; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL-8R B; IL-8 receptor type 2; CD_antigen: CD182

other names :

C-X-C chemokine receptor type 2; C-X-C chemokine receptor type 2; C-X-C chemokine receptor type 2; chemokine (C-X-C motif) receptor 2; CDw128b; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL-8R B; IL-8 receptor type 2; CD_antigen: CD182

products gene name :

CXCR2

other gene names :

CXCR2; CXCR2; CD182; IL8R2; IL8RA; IL8RB; CMKAR2; CDw128b; IL8RB; CXC-R2; CXCR-2; IL-8R B

uniprot entry name :

CXCR2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-40; Fragment at the N-terminal

sequence length :

sequence :

MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPC
E

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Homo sapiens (Human)

products categories :

Signal Transduction

products description :

Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.

products references :

Cloning of complementary DNA encoding a functional human interleukin-8 receptor." Murphy P.M., Tiffany H.L. Science 253:1280-1283(1991)

ncbi gi num :

269973859

ncbi acc num :

NP_001161770.1

ncbi gb acc num :

NM_001168298.1

uniprot acc num :

P25025

ncbi mol weight :

20.63kD

ncbi pathways :

Chemokine Receptors Bind Chemokines Pathway (1269547); Chemokine Signaling Pathway (99051); Chemokine Signaling Pathway (96864); Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Endocytosis Pathway (102279); Endocytosis Pathway (102181); Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway (83102); Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway (515)

ncbi summary :

The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. This receptor also binds to chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA), a protein with melanoma growth stimulating activity, and has been shown to be a major component required for serum-dependent melanoma cell growth. This receptor mediates neutrophil migration to sites of inflammation. The angiogenic effects of IL8 in intestinal microvascular endothelial cells are found to be mediated by this receptor. Knockout studies in mice suggested that this receptor controls the positioning of oligodendrocyte precursors in developing spinal cord by arresting their migration. This gene, IL8RA, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. Alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2009]

uniprot summary :

IL-8R B: Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2. Belongs to the G-protein coupled receptor 1 family. Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Receptor, cytokine; Membrane protein, integral. Chromosomal Location of Human Ortholog: 2q35. Cellular Component: cell surface; cytosol; integral to plasma membrane; intracellular; mast cell granule; membrane; plasma membrane. Molecular Function: C-X-C chemokine receptor activity; interleukin-8 binding; interleukin-8 receptor activity; protein binding; signal transducer activity. Biological Process: acute inflammatory response to antigenic stimulus; cell surface receptor linked signal transduction; cellular defense response; chemotaxis; dendritic cell chemotaxis; elevation of cytosolic calcium ion concentration; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); inflammatory response; midbrain development; negative regulation of neutrophil apoptosis; neutrophil activation; neutrophil chemotaxis; positive regulation of angiogenesis; positive regulation of cell proliferation; positive regulation of vascular permeability; receptor internalization; signal transduction

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.05 mg (Yeast)

price2 :

260

size3 :

0.2 mg (E-Coli)

price3 :

490

size4 :

0.2 mg (Yeast)

price4 :

600

size5 :

0.5 mg (E-Coli)

price5 :

715

more info or order :

MyBioSource product webpage