protein

Recombinant Human Hexokinase-1

MBS949694

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Hexokinase-1

Hexokinase-1

Brain form hexokinaseHexokinase type I; HK I

hexokinase-1 isoform HKI; Hexokinase-1; hexokinase-1; hexokinase 1; Brain form hexokinase; Hexokinase type I; HK I

HK1

HK1; HK1; HKD; HKI; HXK1; HMSNR; HK1-ta; HK1-tb; HK1-tc; HK I

HXK1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-917

917

MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDI
MTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKG
DFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPEN
IVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSF
PCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKK
RGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGT
NACYMEELRHIDLVEGDEGRM

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Metabolism

Human hexokinase sequences of amino- and carboxyl-terminal halves are homologous.Nishi S., Seino S., Bell G.I.Biochem. Biophys. Res. Commun. 157:937-943(1988) Structure of the human hexokinase type I gene and nucleotide sequence of the 5' flanking region.Ruzzo A., Andreoni F., Magnani M.Biochem. J. 331:607-613(1998) The DNA sequence and comparative analysis of human chromosome 10.Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.Nature 429:375-381(2004) Structure of the 5' region of the human hexokinase type I (HKI) gene and identification of an additional testis-specific HKI mRNA.Andreoni F., Ruzzo A., Magnani M.Biochim. Biophys. Acta 1493:19-26(2000) The erythrocyte-specific hexokinase isozyme (HKR) and the common hexokinase isozyme (HKI) are produced from a single gene by alternate promoters.Murakami K., Piomelli S.Blood 90:272-272(1998) Bienvenut W.V., Waridel P., Quadroni M.Submitted (MAR-2009) to UniProtKB Human hexokinase type I microheterogeneity is due to different amino-terminal sequences.Magnani M., Serafini G., Bianchi M., Casabianca A., Stocchi V.J. Biol. Chem. 266:502-505(1991) A recombinant human 'mini'-hexokinase is catalytically active and regulated by hexose 6-phosphates.Magnani M., Bianchi M., Casabianca A., Stocchi V., Daniele A., Altruda F., Ferrone M., Silengo L.Biochem. J. 285:193-199(1992) Identification of the cDNA for human red blood cell-specific hexokinase isozyme.Murakami K., Piomelli S.Blood 89:762-766(1997) Crystallization and preliminary X-ray analysis of human brain hexokinase.Aleshin A.E., Zeng C., Fromm H.J., Honatko R.B.FEBS Lett. 391:9-10(1996) Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.Anal. Chem. 81:4493-4501(2009) A mutation in an alternative untranslated exon of hexokinase 1 associated with hereditary motor and sensory neuropathy -- Russe (HMSNR) .Hantke J., Chandler D., King R., Wanders R.J., Angelicheva D., Tournev I., McNamara E., Kwa M., Guergueltcheva V., Kaneva R., Baas F., Kalaydjieva L.Eur. J. Hum. Genet. 17:1606-1614(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) PKCepsilon promotes oncogenic functions of ATF2 in the nucleus while blocking its apoptotic function at mitochondria.Lau E., Kluger H., Varsano T., Lee K., Scheffler I., Rimm D.L., Ideker T., Ronai Z.A.Cell 148:543-555(2012) The mechanism of regulation of hexokinase new insights from the crystal structure of recombinant human brain hexokinase complexed with glucose and glucose-6-phosphate.Aleshin A.E., Zeng C., Bourenkov G.P., Bartunik H.D., Fromm H.J., Honzatko R.B.Structure 6:39-50(1998) Regulation of hexokinase I crystal structure of recombinant human brain hexokinase complexed with glucose and phosphate.Aleshin A.E., Zeng C., Bartunik H.D., Fromm H.J., Honzatko R.B.J. Mol. Biol. 282:345-357(1998) Binding of non-catalytic ATP to human hexokinase I highlights the structural components for enzyme-membrane association control.Rosano C., Sabini E., Rizzi M., Deriu D., Murshudov G., Bianchi M., Serafini G., Magnani M., Bolognesi M.Structure 7:1427-1437(1999) Crystal structures of mutant monomeric hexokinase I reveal multiple ADP binding sites and conformational changes relevant to allosteric regulation.Aleshin A.E., Kirby C., Liu X., Bourenkov G.P., Bartunik H.D., Fromm H.J., Honzatko R.B.J. Mol. Biol. 296:1001-1015(2000) Hexokinase mutations that produce nonspherocytic hemolytic anemia.Bianchi M., Magnani M.Blood Cells Mol. Dis. 21:2-8(1995) HK Utrecht missense mutation in the active site of human hexokinase associated with hexokinase deficiency and severe nonspherocytic hemolytic anemia.van Wijk R., Rijksen G., Huizinga E.G., Nieuwenhuis H.K., van Solinge W.W.Blood 101:345-347(2003)

188497754

NP_000179.2

NM_000188.2

P19367

106.5kD

Amino Sugar And Nucleotide Sugar Metabolism Pathway (82979); Amino Sugar And Nucleotide Sugar Metabolism Pathway (350); Butirosin And Neomycin Biosynthesis Pathway (145809); Butirosin And Neomycin Biosynthesis Pathway (145786); Carbohydrate Digestion And Absorption Pathway (170720); Carbohydrate Digestion And Absorption Pathway (170654); Carbon Metabolism Pathway (814926); Carbon Metabolism Pathway (817567); Central Carbon Metabolism In Cancer Pathway (1059538); Central Carbon Metabolism In Cancer Pathway (1084231)

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in five transcript variants which encode different isoforms, some of which are tissue-specific. Each isoform has a distinct N-terminus; the remainder of the protein is identical among all the isoforms. A sixth transcript variant has been described, but due to the presence of several stop codons, it is not thought to encode a protein. [provided by RefSeq, Apr 2009]

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180