protein

Recombinant Human DNA nucleotidylexotransferase

MBS949669

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human DNA nucleotidylexotransferase

DNA nucleotidylexotransferase

Terminal addition enzyme Terminal deoxynucleotidyltransferase

DNA nucleotidylexotransferase isoform 2; DNA nucleotidylexotransferase; DNA nucleotidylexotransferase; DNA nucleotidylexotransferase; Terminal addition enzyme; Terminal deoxynucleotidyltransferase; Terminal transferase

TDT

DNTT; DNTT; TDT; ; Terminal transferase

TDT_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-509

508

MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFI
LEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAEN
NSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPV
EMTGKHQLVVRRDYSDSTNPGPPKTPPIAVQKISQYACQ
RRTTLNNCNQIFTDAFDILAENCEFRENEDSCVTFMRAA
SVLKSLPFTIISMKDTEGIPCLGSKVKGIIEEIIEDGES
SEVKAVLNDERYQSFKLFTSV

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Immunology

template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor gene segments during the maturation of B- and T-cells.

Expression of human terminal deoxynucleotidyl transferase in Escherichia coli.Peterson R.C., Cheung L.C., Mattaliano R.J., White S.T., Chang L.M.S., Bollum F.J.J. Biol. Chem. 260:10495-10502(1985) Human terminal deoxyribonucleotidyltransferase molecular cloning and structural analysis of the gene and 5' flanking region.Riley L.K., Morrow J.K., Danton M.J., Coleman M.S.Proc. Natl. Acad. Sci. U.S.A. 85:2489-2493(1988) Terminal deoxynucleotidyltransferase is negatively regulated by direct interaction with proliferating cell nuclear antigen.Ibe S., Fujita K., Toyomoto T., Shimazaki N., Kaneko R., Tanabe A., Takebe I., Kuroda S., Kobayashi T., Toji S., Tamai K., Yamamoto H., Koiwai O.Genes Cells 6:815-824(2001) Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. The DNA sequence and comparative analysis of human chromosome 10.Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.Nature 429:375-381(2004) Isolation of putative promoter region for human terminal deoxynucleotidyltransferase gene.Koiwai O., Morita A.Biochem. Biophys. Res. Commun. 154:91-100(1988) Molecular cloning of human terminal deoxynucleotidyltransferase.Peterson R.C., Cheung L.C., Mattaliano R.J., Chang L.M.S., Bollum F.J.Proc. Natl. Acad. Sci. U.S.A. 81:4363-4367(1984) Mutational analysis of residues in the nucleotide binding domain of human terminal deoxynucleotidyl transferase.Yang B., Gathy K.N., Coleman M.S.J. Biol. Chem. 269:11859-11868(1994) Terminal deoxynucleotidyltransferase directly interacts with a novel nuclear protein that is homologous to p65.Yamashita N., Shimazaki N., Ibe S., Kaneko R., Tanabe A., Toyomoto T., Fujita K., Hasegawa T., Toji S., Tamai K., Yamamoto H., Koiwai O.Genes Cells 6:641-652(2001) Terminal deoxynucleotidyltransferase forms a ternary complex with a novel chromatin remodeling protein with 82 kDa and core histone.Fujita K., Shimazaki N., Ohta Y., Kubota T., Ibe S., Toji S., Tamai K., Fujisaki S., Hayano T., Koiwai O.Genes Cells 8:559-571(2003) Role of human Pso4 in mammalian DNA repair and association with terminal deoxynucleotidyl transferase.Mahajan K.N., Mitchell B.S.Proc. Natl. Acad. Sci. U.S.A. 100:10746-10751(2003) Direct binding of TReP-132 with TdT results in reduction of TdT activity.Fujisaki S., Sato A., Toyomoto T., Hayano T., Sugai M., Kubota T., Koiwai O.Genes Cells 11:47-57(2006) Solution structure of BRCT domain of terminal deoxynucleotidyltransferase.RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank

63054852

NP_001017520.1

NM_001017520.1

P04053

62.6kD

Hematopoietic Cell Lineage Pathway (83078); Hematopoietic Cell Lineage Pathway (489); Non-homologous End-joining Pathway (83047); Non-homologous End-joining Pathway (455); Validated Targets Of C-MYC Transcriptional Repression Pathway (169353)

This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jul 2008]

DNTT: Template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor gene segments during the maturation of B- and T-cells. Belongs to the DNA polymerase type-X family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Transferase; EC 2.7.7.31. Chromosomal Location of Human Ortholog: 10q23-q24. Cellular Component: cytoplasm; nucleoplasm; nucleus. Molecular Function: DNA binding; DNA nucleotidylexotransferase activity; DNA-directed DNA polymerase activity; metal ion binding; protein binding. Biological Process: DNA metabolic process; DNA modification

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180

0.5 mg (Yeast)

1515