Recombinant Human Apolipoprotein C-II | MyBioSource MBS949618 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Apolipoprotein C-II

catalog :

MBS949618

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS949618

products type :

Recombinant Protein

products full name :

Recombinant Human Apolipoprotein C-II

products short name :

Apolipoprotein C-II

products name syn :

Apolipoprotein C2

other names :

apolipoprotein C-II; Apolipoprotein C-II; apolipoprotein C-II; apolipoprotein C-II; Apolipoprotein C2

products gene name :

APOC2

other gene names :

APOC2; APOC2; APO-CII; APOC-II; APC2; Apo-CII; ApoC-II; ProapoC-II

uniprot entry name :

APOC2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

23-101

sequence length :

101

sequence :

TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEK
TYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGE
E

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Metabolism

products description :

Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridic individuals, predominantly found in the VLDL and LDL.

products references :

The human preproapolipoprotein C-II gene. Complete nucleic acid sequence and genomic organization.Fojo S.S., Law S.W., Brewer H.B. Jr.FEBS Lett. 213:221-226(1987)

ncbi gi num :

32130518

ncbi acc num :

NP_000474.2

ncbi gb acc num :

NM_000483.4

uniprot acc num :

P02655

ncbi mol weight :

24.9kD

ncbi pathways :

Chylomicron-mediated Lipid Transport Pathway (1270006); HDL-mediated Lipid Transport Pathway (1270007); Lipid Digestion, Mobilization, And Transport Pathway (1270002); Lipoprotein Metabolism Pathway (1270005); Metabolism Pathway (1269956); Metabolism Of Fat-soluble Vitamins Pathway (1339147); Metabolism Of Lipids And Lipoproteins Pathway (1270001); Metabolism Of Vitamins And Cofactors Pathway (1270144); Retinoid Metabolism And Transport Pathway (1269624); Signal Transduction Pathway (1269379)

ncbi summary :

This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. [provided by RefSeq, Mar 2011]

uniprot summary :

APOC2: Component of the very low density lipoprotein (VLDL) fraction in plasma, and is an activator of several triacylglycerol lipases. The association of APOC2 with plasma chylomicrons, VLDL, and HDL is reversible, a function of the secretion and catabolism of triglyceride-rich lipoproteins, and changes rapidly. Defects in APOC2 are the cause of hyperlipoproteinemia type 1B (HLPP1B). It is an autosomal recessive trait characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. Belongs to the apolipoprotein C2 family. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 19q13.2. Cellular Component: chylomicron; early endosome; extracellular region; extracellular space. Molecular Function: lipase inhibitor activity; lipid binding; phospholipase activator activity; phospholipase binding; protein homodimerization activity. Biological Process: cholesterol efflux; cholesterol homeostasis; fat-soluble vitamin metabolic process; lipid catabolic process; lipoprotein metabolic process; negative regulation of catalytic activity; negative regulation of cholesterol transport; negative regulation of lipid metabolic process; negative regulation of receptor-mediated endocytosis; phospholipid efflux; phototransduction, visible light; positive regulation of fatty acid biosynthetic process; positive regulation of lipoprotein lipase activity; retinoid metabolic process; reverse cholesterol transport; vitamin metabolic process. Disease: Apolipoprotein C-ii Deficiency

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage