protein

Recombinant Human Platelet glycoprotein Ib alpha chain

MBS949615

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Platelet glycoprotein Ib alpha chain

Platelet glycoprotein Ib alpha chain

Antigen CD42b-alpha; CD42b

platelet glycoprotein Ib alpha chain; Platelet glycoprotein Ib alpha chain; platelet glycoprotein Ib alpha chain; glycoprotein Ib platelet alpha subunit; Antigen CD42b-alpha; CD_antigen: CD42b

GP1BA

GP1BA; GP1BA; BSS; GP1B; VWDP; CD42B; GPIbA; BDPLT1; BDPLT3; DBPLT3; GPIbalpha; CD42b-alpha; GP-Ib alpha; GPIb-alpha; GPIbA; Glycoprotein Ibalpha

GP1BA_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

17-505

652

HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLS
ENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPV
LGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPL
GALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLA
NNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSH
LLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGV
DVKAMTSNVASVQCDNSDKFP

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cardiovascular

GP-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to the A1 domain of vWF, which is already bound to the subendothelium.

Cloning of the alpha chain of human platelet glycoprotein Ib a transmembrane protein with homology to leucine-rich alpha 2-glycoprotein.Lopez J.A., Chung D.W., Fujikawa K., Hagen F.S., Papayannopoulou T., Roth G.J.Proc. Natl. Acad. Sci. U.S.A. 84:5615-5619(1987) Structure of the human blood platelet membrane glycoprotein Ib alpha gene.Wenger R.H., Kieffer N., Wicki A.N., Clemetson K.J.Biochem. Biophys. Res. Commun. 156:389-395(1988) A novel polymorphism, 70Leu/Phe, disrupts a consensus Leu residue within the leucine-rich repeat sequence of platelet glycoprotein Ibalpha.Matsubara Y., Murata M., Moriki T., Yokoyama K., Watanabe N., Nakajima H., Handa M., Kawano K., Aoki N., Yoshino H., Ikeda Y.Thromb. Haemost. 87:867-872(2002) Identification of a novel point mutation in platelet glycoprotein Ibalpha, Gly to Ser at residue 233, in a Japanese family with platelet-type von Willebrand disease.Matsubara Y., Murata M., Sugita K., Ikeda Y.J. Thromb. Haemost. 1:2198-2205(2003) SeattleSNPs variation discovery resourceDNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006) Amino acid sequence of the von Willebrand factor-binding domain of platelet membrane glycoprotein Ib.Titani K., Takio K., Handa M., Ruggeri Z.M.Proc. Natl. Acad. Sci. U.S.A. 84:5610-5614(1987) Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.Nat. Biotechnol. 21:566-569(2003) StyI polymorphism at nucleotide 1610 in the human platelet glycoprotein Ib alpha gene.Suzuki K., Hayashi T., Akiba J., Yahagi A., Tajima K., Satoh S., Sasaki H.Jpn. J. Hum. Genet. 41:419-421(1996) Identification of the disulphide bonds in human platelet glycocalicin.Hess D., Schaller J., Rickli E.E., Clemetson K.J.Eur. J. Biochem. 199:389-393(1991) Human beta-filamin is a new protein that interacts with the cytoplasmic tail of glycoprotein Ibalpha.Takafuta T., Wu G., Murphy G.F., Shapiro S.S.J. Biol. Chem. 273:17531-17538(1998) Elucidation of N-glycosylation sites on human platelet proteins a glycoproteomic approach.Lewandrowski U., Moebius J., Walter U., Sickmann A.Mol. Cell. Proteomics 5:226-233(2006) Glycoprotein Ibalpha forms disulfide bonds with 2 glycoprotein Ibbeta subunits in the resting platelet.Luo S.Z., Mo X., Afshar-Kharghan V., Srinivasan S., Lopez J.A., Li R.Blood 109:603-609(2007) Phosphoproteome of resting human platelets.Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A.J. Proteome Res. 7:526-534(2008) Crystal structure of the platelet glycoprotein Ibalpha N-terminal domain reveals an unmasking mechanism for receptor activation.Uff S., Clemetson J.M., Harrison T., Clemetson K.J., Emsley J.J. Biol. Chem. 277:35657-35663(2002) Structures of glycoprotein Ibalpha and its complex with von Willebrand factor A1 domain.Huizinga E.G., Tsuji S., Romijn R.A., Schiphorst M.E., de Groot P.G., Sixma J.J., Gros P.Science 297:1176-1179(2002) Molecular modeling of the seven tandem leucine-rich repeats within the ligand-binding region of platelet glycoprotein Ib alpha.Whisstock J.C., Shen Y., Lopez J.A., Andrews R.K., Berndt M.C.Thromb. Haemost. 87:329-333(2002) Genetic and structural characterization of an amino acid dimorphism in glycoprotein Ib alpha involved in platelet transfusion refractoriness.Murata M., Furihata K., Ishida F., Russell S.R., Ware J., Ruggeri Z.M.Blood 79:3086-3090(1992) Mutation of leucine-57 to phenylalanine in a platelet glycoprotein Ib alpha leucine tandem repeat occurring in patients with an autosomal dominant variant of Bernard-Soulier disease.Miller J.L., Lyle V.A., Cunningham D.Blood 79:439-446(1992) Polymorphism of human glycoprotein Ib alpha results from a variable number of tandem repeats of a 13-amino acid sequence in the mucin-like macroglycopeptide region. Structure/function implications.Lopez J.A., Ludwig E.H., McCarthy B.J.J. Biol. Chem. 267:10055-10061(1992) Point mutation in a leucine-rich repeat of platelet glycoprotein Ib alpha resulting in the Bernard-Soulier syndrome.Ware J., Russell S.R., Marchese P., Murata M., Mazzucato M., de Marco L., Ruggeri Z.M.J. Clin. Invest. 92:1213-1220(1993) Cys209 Ser mutation in the platelet membrane glycoprotein Ib alpha gene is associated with Bernard-Soulier syndrome.Simsek S., Noris P., Lozano M., Pico M., von Dem Borne A.E.G.K., Ribera A., Gallardo D.Br. J. Haematol. 88:839-844(1994) Mutation in the gene encoding the alpha chain of platelet glycoprotein Ib in platelet-type von Willebrand disease.Miller J.L., Cunningham D., Lyle V.A., Finch C.N.Proc. Natl. Acad. Sci. U.S.A. 88:4761-4765(1991) Expression of the phenotypic abnormality of platelet-type von Willebrand disease in a recombinant glycoprotein Ib alpha fragment.Murata M., Russell S.R., Ruggeri Z.M., Ware J.J. Clin. Invest. 91:2133-2137(1993) Pseudo-von Willebrand disease a mutation in the platelet glycoprotein Ib alpha gene associated with a hyperactive surface receptor.Russell S.D., Roth G.J.Blood 81:1787-1791(1993) The largest variant of platelet glycoprotein Ib alpha has four tandem repeats of 13 amino acids in the macroglycopeptide region and a genetic linkage with methionine145.Ishida F., Furihata K., Ishida K., Yan J., Kitano K., Kiyosawa K., Furuta S.Blood 86:1357-1360(1995) A three-base deletion removing a leucine residue in a leucine-rich repeat of platelet glycoprotein Ib alpha associated with a variant of Bernard-Soulier syndrome (Nancy I) .de la Salle C., Baas M.-J., Lanza F., Schwartz A., Hanau D., Chevalier J., Gachet C., Briquel M.-E., Cazenave J.-P.Br. J. Haematol. 89:386-396(1995) Naturally occurring mutations in glycoprotein Ibalpha that result in defective ligand binding and synthesis of a truncated protein.Kenny D., Jonsson O.G., Morateck P.A., Montgomery R.R.Blood 92:175-183(1998) Characterization of single-nucleotide polymorphisms in coding regions of human genes.Cargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 22:231-238(1999) ErratumCargill M., Altshuler D., Ireland J., Sklar P., Ardlie K., Patil N., Shaw N., Lane C.R., Lim E.P., Kalyanaraman N., Nemesh J., Ziaugra L., Friedland L., Rolfe A., Warrington J., Lipshutz R., Daley G.Q., Lander E.S.Nat. Genet. 23:373-373(1999) Molecular characterization of two mutations in platelet glycoprotein (GP) Ib alpha in two Finnish Bernard-Soulier syndrome families.Koskela S., Partanen J., Salmi T.T., Kekomaki R.Eur. J. Haematol. 62:160-168(1999) Autosomal dominant macrothrombocytopenia in Italy is most frequently a type of heterozygous Bernard-Soulier syndrome.Savoia A., Balduini C.L., Savino M., Noris P., Del Vecchio M., Perrotta S., Belletti S., Poggi V., Iolascon A.Blood 97:1330-1335(2001) Nonarteritic anterior ischemic optic neuropathy is associated with a specific platelet polymorphism located on the glycoprotein Ibalpha gene.Salomon O., Rosenberg N., Steinberg D.M., Huna-Baron R., Moisseiev J., Dardik R., Goldan O., Kurtz S., Ifrah A., Seligsohn U.Ophthalmology 111:184-188(2004) +Additional computationally mapped references. p>Provides general information on the entry.

291190772

NP_000164.5

NM_000173.6

P07359

58kD

ECM-receptor Interaction Pathway (83068); ECM-receptor Interaction Pathway (479); Formation Of Fibrin Clot (Clotting Cascade) Pathway (1269368); GP1b-IX-V Activation Signalling Pathway (1269351); Hematopoietic Cell Lineage Pathway (83078); Hematopoietic Cell Lineage Pathway (489); Hemostasis Pathway (1269340); Intrinsic Pathway Of Fibrin Clot Formation (1269370); Platelet Adhesion To Exposed Collagen Pathway (1269349); Platelet Aggregation (Plug Formation) Pathway (1269358)

Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that is linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. This gene encodes the alpha subunit. Mutations in this gene result in Bernard-Soulier syndromes and platelet-type von Willebrand disease. The coding region of this gene is known to contain a polymophic variable number tandem repeat (VNTR) domain that is associated with susceptibility to nonarteritic anterior ischemic optic neuropathy. [provided by RefSeq, Oct 2013]

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750