Recombinant Human Glucagon-like peptide 1 receptor | MyBioSource MBS949592 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Glucagon-like peptide 1 receptor

catalog :

MBS949592

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS949592

products type :

Recombinant Protein

products full name :

Recombinant Human Glucagon-like peptide 1 receptor

products short name :

Glucagon-like peptide 1 receptor

other names :

glucagon-like peptide 1 receptor; Glucagon-like peptide 1 receptor; glucagon-like peptide 1 receptor; glucagon like peptide 1 receptor

products gene name :

GLP1R

other gene names :

GLP1R; GLP1R; GLP-1 receptor; GLP-1-R; GLP-1R

uniprot entry name :

GLP1R_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

24-145; Provide the extracellular domain.

sequence length :

145

sequence :

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFC
NRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVY
RFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQ
LLFLY

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cardiovascular

products description :

This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

products references :

Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor.Thorens B., Porret A., Buehler L., Deng S., Morel P., Widmann C.Diabetes 42:1678-1682(1993) Cloning and functional expression of the human glucagon-like peptide-1 (GLP-1) receptor.Dillon J.S., Tanizawa Y., Wheeler M.B., Leng X., Ligon B.B., Rabin D.U., Yoo-Warren H., Permutt M., Boyd A.E.Endocrinology 133:1907-1910(1993) Cloning and functional expression of a human glucagon-like peptide-1 receptor.Graziano M.P., Hey P.J., Borkowski D., Chicchi G.C., Strader C.D.Biochem. Biophys. Res. Commun. 196:141-146(1993) Signal transduction of the GLP-1-receptor cloned from a human insulinoma.van Eyll B., Lankat-Buttgereit B., Bode H.P., Goeke R., Goeke B.FEBS Lett. 348:7-13(1994) Tissue-specific expression of the human receptor for glucagon-like peptide-I brain, heart and pancreatic forms have the same deduced amino acid sequences.Wei Y., Mojsov S.FEBS Lett. 358:219-224(1995) Genome-wide discovery and analysis of human seven transmembrane helix receptor genes.Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.NIEHS SNPs programThe DNA sequence and analysis of human chromosome 6.Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.Nature 425:805-811(2003) Cloning and characterization of the 5' flanking sequences (promoter region) of the human GLP-1 receptor gene.Lankat-Buttgereit B., Goeke B.Peptides 18:617-624(1997) Functional coupling of Cys-226 and Cys-296 in the glucagon-like peptide-1 (GLP-1) receptor indicates a disulfide bond that is close to the activation pocket.Mann R.J., Al-Sabah S., de Maturana R.L., Sinfield J.K., Donnelly D.Peptides 31:2289-2293(2010) Glucagon like-peptide-1 receptor is covalently modified by endogenous mono-ADP-ribosyltransferase.Dezelak M., Bavec A.Mol. Biol. Rep. 39:4375-4381(2012) Regulation of GIP and GLP1 receptor cell surface expression by N-glycosylation and receptor heteromerization.Whitaker G.M., Lynn F.C., McIntosh C.H., Accili E.A.PLoS ONE 7:E32675-E32675(2012) Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular domain.Runge S., Thogersen H., Madsen K., Lau J., Rudolph R.J. Biol. Chem. 283:11340-11347(2008)

ncbi gi num :

166795283

ncbi acc num :

NP_002053.3

ncbi gb acc num :

NM_002062.3

uniprot acc num :

P43220

ncbi mol weight :

18.4kD

ncbi pathways :

Class B/2 (Secretin Family Receptors) Pathway (1269570); G Alpha (s) Signalling Events Pathway (1269575); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); GPCRs, Class B Secretin-like Pathway (198781); Glucagon-like Peptide-1 (GLP1) Regulates Insulin Secretion Pathway (1270107); Glucagon-type Ligand Receptors Pathway (1269572); Insulin Secretion Pathway (777534); Integration Of Energy Metabolism Pathway (1270101); Metabolism Pathway (1269956)

uniprot summary :

GLP1R: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 2 family. Protein type: Membrane protein, integral; Receptor, GPCR; GPCR, family 2; Membrane protein, multi-pass. Chromosomal Location of Human Ortholog: 6p21. Cellular Component: cytosol; integral to membrane; intracellular; plasma membrane. Molecular Function: glucagon receptor activity; protein binding; transmembrane receptor activity. Biological Process: adenylate cyclase activation; cAMP-mediated signaling; cell surface receptor linked signal transduction; elevation of cytosolic calcium ion concentration; energy reserve metabolic process; G-protein coupled receptor protein signaling pathway; learning and/or memory; positive regulation of blood pressure; regulation of heart contraction; regulation of insulin secretion; response to stress

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

260

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.5 mg (E-Coli)

price4 :

750

size5 :

0.2 mg (Yeast)

price5 :

835

more info or order :

MyBioSource product webpage