Recombinant Mouse Transthyretin | MyBioSource MBS949561 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Transthyretin

catalog :

MBS949561

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS949561

products type :

Recombinant Protein

products full name :

Recombinant Mouse Transthyretin

products short name :

Transthyretin

products name syn :

Prealbumin

other names :

transthyretin; Transthyretin; transthyretin; transthyretin; Prealbumin

products gene name :

Ttr

other gene names :

Ttr; Ttr; D17860; AA408768; AI787086; prealbumin

uniprot entry name :

TTHY_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

23-147; Full length

sequence length :

147

sequence :

GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEG
SWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSY
WKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYS
TTAVVSNPQN

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.

products references :

Structural comparisons between mouse and human prealbumin.Wakasugi S., Maeda S., Shimada K., Nakashima H., Migita S.J. Biochem. 98:1707-1714(1985) Structure and expression of the mouse prealbumin gene.Wakasugi S., Maeda S., Shimada K.J. Biochem. 100:49-58(1986) Kita H., Kawamoto S., Okubo K., Matsubara K. Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides.Bernhard O.K., Kapp E.A., Simpson R.J.J. Proteome Res. 6:987-995(2007) Human-murine transthyretin heterotetramers are kinetically stable and non-amyloidogenic. A lesson in the generation of transgenic models of diseases involving oligomeric proteins.Reixach N., Foss T.R., Santelli E., Pascual J., Kelly J.W., Buxbaum J.N.J. Biol. Chem. 283:2098-2107(2008)

ncbi gi num :

7305599

ncbi acc num :

NP_038725.1

ncbi gb acc num :

NM_013697.5

uniprot acc num :

P07309

ncbi mol weight :

29.5kD

ncbi pathways :

Extracellular Matrix Organization Pathway (1323909); Metabolism Pathway (1324226); Metabolism Of Fat-soluble Vitamins Pathway (1324415); Metabolism Of Vitamins And Cofactors Pathway (1324401); Non-integrin Membrane-ECM Interactions Pathway (1323919); Retinoid Metabolism And Transport Pathway (1324417); Signal Transduction Pathway (1324550); The Canonical Retinoid Cycle In Rods (twilight Vision) Pathway (1324783); Visual Phototransduction Pathway (1324782)

ncbi summary :

This gene encodes a carrier protein responsible for the transport of thyroid hormones and retinol. The protein consists of a tetramer of identical subunits. Due to increased stability of the tetramer form of this encoded protein in mouse, compared to the human protein, this gene product has a reduced tendency to form amyloid fibrils. In humans, this protein binds beta-amyloid preventing its aggregation and providing a neuroprotective role in Alzheimer's disease. [provided by RefSeq, Mar 2010]

uniprot summary :

TTR: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. Defects in TTR are the cause of amyloidosis transthyretin-related (AMYL-TTR). A hereditary generalized amyloidosis due to transthyretin amyloid deposition. Protein fibrils can form in different tissues leading to amyloid polyneuropathies, amyloidotic cardiomyopathy, carpal tunnel syndrome, systemic senile amyloidosis. The disease includes leptomeningeal amyloidosis that is characterized by primary involvement of the central nervous system. Neuropathologic examination shows amyloid in the walls of leptomeningeal vessels, in pia arachnoid, and subpial deposits. Some patients also develop vitreous amyloid deposition that leads to visual impairment (oculoleptomeningeal amyloidosis). Clinical features include seizures, stroke-like episodes, dementia, psychomotor deterioration, variable amyloid deposition in the vitreous humor. Defects in TTR are a cause of hyperthyroxinemia dystransthyretinemic euthyroidal (HTDE). It is a condition characterized by elevation of total and free thyroxine in healthy, euthyroid persons without detectable binding protein abnormalities. Defects in TTR are a cause of carpal tunnel syndrome type 1 (CTS1). It is a condition characterized by entrapment of the median nerve within the carpal tunnel. Symptoms include burning pain and paresthesias involving the ventral surface of the hand and fingers which may radiate proximally. Impairment of sensation in the distribution of the median nerve and thenar muscle atrophy may occur. This condition may be associated with repetitive occupational trauma, wrist injuries, amyloid neuropathies, rheumatoid arthritis. Belongs to the transthyretin family. Protein type: Secreted, signal peptide; Secreted. Cellular Component: extracellular region; extracellular space; protein complex. Molecular Function: hormone activity; hormone binding; identical protein binding; protein binding; protein heterodimerization activity. Biological Process: retinol metabolic process; transport

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

255

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

665

size5 :

0.5 mg (E-Coli)

price5 :

750

more info or order :

MyBioSource product webpage