catalog number :
MBS949534
products type :
Recombinant Protein
products full name :
Recombinant Rat Aquaporin-3 (Aqp3)
products short name :
Aquaporin-3 (Aqp3)
other names :
aquaporin-3; Aquaporin-3; aquaporin-3; AQP-3; aquaglyceroporin-3; 31.4 kDa water channel protein; aquaporin 3; 31.4 kDa water channel protein; Aquaglyceroporin-3
products gene name syn :
Recombinant Aquaporin-3 (Aqp3); Aquaporin-3; AQP-3; 31.4 kDa water channel protein Aquaglyceroporin-3
other gene names :
Aqp3; Aqp3; AQP-3
uniprot entry name :
AQP3_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-292
sequence :
MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFG
CGSVAQVVLSRGTHGGFLTINLAFGFAVTLAILVAGQVS
GAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAG
IVFGLYYDAIWAFAGNELVVSGPNGTAGIFATYPSGHLD
MVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTV
GLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSE
VFTTGQNWWWVPIVSPLLGSIGGVFVYQLMIGCHLEQPP
PSTEAENVKLAHMKHKEQI
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
other info1 :
Species: Rattus norvegicus (Rat)
products description :
Water channel required to promote glycerol permeability and water transport across cell membranes. Acts as a glycerol transporter in skin and plays an important role in regulating SC (stratum corneum) and epidermal glycerol content. Involved in skin hydration, wound healing, and tumorigenesis. Provides kidney medullary collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Slightly permeable to urea and may function as a water and urea exit mechanism in antidiuresis in collecting duct cells. It may play an important role in gastrointestinal tract water transport and in glycerol metabolism.
ncbi acc num :
NP_113891.1
ncbi gb acc num :
NM_031703.1
ncbi pathways :
Aquaporin-mediated Transport Pathway (649862); Passive Transport By Aquaporins Pathway (649863); Regulation Of Water Balance By Renal Aquaporins Pathway (649864); Transmembrane Transport Of Small Molecules Pathway (649824); Vasopressin-regulated Water Reabsorption Pathway (143692); Vasopressin-regulated Water Reabsorption Pathway (143631)
ncbi summary :
acts as a water transport channel in the collecting duct of the renal medulla [RGD, Feb 2006]
uniprot summary :
Function: Water channel required to promote glycerol permeability and water transport across cell membranes. Acts as a glycerol transporter in skin and plays an important role in regulating SC (stratum corneum) and epidermal glycerol content. Involved in skin hydration, wound healing, and tumorigenesis. Provides kidney medullary collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Slightly permeable to urea and may function as a water and urea exit mechanism in antidiuresis in collecting duct cells. It may play an important role in gastrointestinal tract water transport and in glycerol metabolism. Ref.1. Subcellular location: Membrane; Multi-pass membrane protein. Tissue specificity: Renal medulla and colon. Predominantly in the inner medulla. Domain: Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA). Sequence similarities: Belongs to the MIP/aquaporin (TC 1.A.8) family. [View classification]. Sequence caution: The sequence BAA04559.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.