Recombinant Mouse Pyridoxal phosphate phosphatase (Pdxp) | MyBioSource MBS949456 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Pyridoxal phosphate phosphatase (Pdxp)

catalog :

MBS949456

quantity :

0.01 mg (E-Coli)

price :

200 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS949456

products type :

Recombinant Protein

products full name :

Recombinant Mouse Pyridoxal phosphate phosphatase (Pdxp)

products short name :

[Pyridoxal phosphate phosphatase (Pdxp)]

products name syn :

[Pyridoxal phosphate phosphatase; PLP phosphatase; EC=3.1.3.3; EC=3.1.3.74; Chronophin]

other names :

[pyridoxal phosphate phosphatase; Pyridoxal phosphate phosphatase; pyridoxal phosphate phosphatase; chronophin; chronophilin; PLP phosphatase; PLP-phosophatase; pyridoxal (pyridoxine, vitamin B6) phosphatase; Chronophin]

products gene name :

[Pdxp]

products gene name syn :

[Pdxp; Cin; Plp; Plpp]

other gene names :

[Pdxp; Pdxp; PLPP; AB041662; 1600027H05Rik; Cin; Plp; Plpp; PLP phosphatase]

uniprot entry name :

PLPP_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[1-292aa; Full Length]

sequence length :

292

sequence :

MARCERLRGAALRDVLGQAQGVLFDCDGVLWNGERIVPG
APELLQRLARAGKNTLFVSNNSRRARPELALRFARLGFA
GLRAEQLFSSALCAARLLRQRLSGPPDASGAVFVLGGEG
LRAELRAAGLRLAGDPGEDPRVRAVLVGYDEQFSFSRLT
EACAHLRDPDCLLVATDRDPWHPLSDGSRTPGTGSLAAA
VETASGRQALVVGKPSPYMFQCITEDFSVDPARTLMVGD
RLETDILFGHRCGMTTVLTLTGVSSLEEAQAYLTAGQRD
LVPHYYVESIADLMEGLED

purity :

>=90%

form :

Liquid containing glycerol

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

image1 heading :

SDS-Page

other info1 :

Species: Mus musculus (Mouse)

other info2 :

Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

products categories :

Signal Transduction

products description :

Protein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis (By similarity). Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho-tyrosine. Pyridoxal phosphate phosphatase. Has some activity towards pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PMP) and pyridoxine 5'-phosphate (PNP), with a highest activity with PLP followed by PNP.

ncbi gi num :

47059486

ncbi acc num :

NP_064667.2

ncbi gb acc num :

NM_020271.3

uniprot acc num :

P60487

ncbi mol weight :

31,512 Da

ncbi pathways :

Metabolic Pathways (132962); Vitamin B6 Metabolism Pathway (83211); Vitamin B6 Metabolism Pathway (399)

uniprot summary :

PDXP: Protein serine phosphatase that dephosphorylates Ser-3 in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho- tyrosine. Pyridoxal phosphate phosphatase. Has some activity towards pyridoxal 5 -phosphate (PLP), pyridoxine 5 -phosphate (PMP) and pyridoxine 5 -phosphate (PNP), with a highest activity with PLP followed by PNP. Homodimer. Ubiquitous. Highly expressed in all the regions of central nerve system except the spinal cord. Also expressed at high level in liver and testis. In fetus, it is weakly expressed in all organs except brain. Inhibited by NaF, Zn(2+), Ca(2+), Mn(2+) and EDTA. Belongs to the HAD-like hydrolase superfamily. Protein type: Cofactor and Vitamin Metabolism - vitamin B6; EC 3.1.3.74; Cell cycle regulation; EC 3.1.3.3; Protein phosphatase, Ser/Thr (non-receptor). Cellular Component: lamellipodium; plasma membrane; intercellular junction; midbody; cytosol; cleavage furrow; actin cytoskeleton. Molecular Function: heat shock protein binding; phosphoprotein phosphatase activity. Biological Process: actin rod formation; positive regulation of actin filament depolymerization; regulation of mitosis; protein amino acid dephosphorylation; regulation of cytokinesis

size1 :

0.01 mg (E-Coli)

price1 :

200 USD

size2 :

0.01 mg (Yeast)

price2 :

230

size3 :

0.05 mg (E-Coli)

price3 :

260

size4 :

0.05 mg (Yeast)

price4 :

305

size5 :

0.1 mg (E-Coli)

price5 :

430

size6 :

0.1 mg (Yeast)

price6 :

510

size7 :

0.2 mg (E-Coli)

price7 :

685

size8 :

0.2 mg (Yeast)

price8 :

815

size9 :

0.5 mg (E-Coli)

price9 :

1125

size10 :

0.5 mg (Yeast)

price10 :

1345

size11 :

1 mg (E-Coli)

price11 :

1725

size12 :

1 mg (Yeast)

price12 :

2065

more info or order :

MyBioSource product webpage