product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Apolipoprotein C-III
catalog :
MBS949386
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS949386
products type :
Recombinant Protein
products full name :
Recombinant Rat Apolipoprotein C-III
products short name :
Apolipoprotein C-III
products name syn :
Apolipoprotein C3
other names :
Apolipoprotein C-III; Apolipoprotein C-III; Apolipoprotein C3
products gene name :
Apoc3
other gene names :
Apoc3; Apo-CIII; ApoC-III
uniprot entry name :
APOC3_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
21-101
sequence length :
101
sequence :
DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVA
SRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPT
LEP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors.
products references :
Linkage, evolution, and expression of the rat apolipoprotein A-I, C-III, and A-IV genes.Haddad I.A., Ordovas J.M., Fitzpatrick T., Karathanasis S.K.J. Biol. Chem. 261:13268-13277(1986) Haddad I.A., Ordovas J.M., Fitzpatrick T., Karathanasis S.K.
ncbi gi num :
6226553
ncbi acc num :
P06759.2
uniprot acc num :
P06759
ncbi mol weight :
11kD
ncbi pathways :
Chylomicron-mediated Lipid Transport Pathway (1333315); HDL-mediated Lipid Transport Pathway (1333316); Lipid Digestion, Mobilization, And Transport Pathway (1333311); Lipoprotein Metabolism Pathway (1333314); Metabolism Pathway (1333271); Metabolism Of Fat-soluble Vitamins Pathway (1333460); Metabolism Of Lipids And Lipoproteins Pathway (1333310); Metabolism Of Vitamins And Cofactors Pathway (1333446); PPAR Signaling Pathway (83434); PPAR Signaling Pathway (450)
uniprot summary :
APOC3: Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Protein type: Secreted, signal peptide; Lipid-binding; Secreted. Cellular Component: cell; chylomicron; extracellular space. Molecular Function: enzyme regulator activity; lipase inhibitor activity; lipid transporter activity; phospholipid binding. Biological Process: cholesterol efflux; cholesterol homeostasis; cholesterol metabolic process; G-protein coupled receptor protein signaling pathway; inflammatory response; lipid catabolic process; lipid transport; lipoprotein metabolic process; lipoprotein transport; negative regulation of fatty acid biosynthetic process; negative regulation of lipid catabolic process; negative regulation of lipid metabolic process; negative regulation of lipoprotein lipase activity; negative regulation of receptor-mediated endocytosis; phospholipid efflux; regulation of Cdc42 protein signal transduction; response to drug; response to nutrient; response to peptide hormone stimulus; response to triglyceride; response to vitamin A; triacylglycerol catabolic process; triacylglycerol metabolic process; triacylglycerol mobilization
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
810
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1035
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!