product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Beta-galactoside alpha-2,6-sialyltransferase 1 (St6gal1)
catalog :
MBS949158
quantity :
1 mg (E Coli Derived
price :
1840 USD
more info or order :
product information
catalog number :
MBS949158
products type :
Recombinant Protein
products full name :
Recombinant Rat Beta-galactoside alpha-2,6-sialyltransferase 1 (St6gal1)
products short name :
Beta-galactoside alpha-2,6-sialyltransferase 1 (St6gal1)
products name syn :
Recombinant Beta-galactoside alpha-2,6-sialyltransferase 1 (St6gal1); Beta-galactoside alpha-2,6-sialyltransferase 1; Alpha 2,6-ST 1 EC= 2.4.99.1; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1 ST6Gal I; ST6GalI Sialyltransferase
other names :
beta-galactoside alpha-2,6-sialyltransferase 1 isoform 1; Beta-galactoside alpha-2,6-sialyltransferase 1; beta-galactoside alpha-2,6-sialyltransferase 1; ST6GalI; ST6Gal I; alpha 2,6-ST 1; beta galactoside alpha 2,6 sialyltransferase 1; Sialyltransferase 1 (beta-galactoside alpha-26-sialytransferase); Sialyltransferase 1 (beta-galactoside alpha-2,6-sialytransferase); CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6Gal I; ST6GalI; Sialyltransferase 1
products gene name syn :
St6gal1; Siat1
other gene names :
St6gal1; St6gal1; Siat1; Siat1; Alpha 2,6-ST 1; ST6GalI
uniprot entry name :
SIAT1_RAT
host :
E Coli or Yeast
sequence positions :
1-403
sequence length :
403
sequence :
MIHTNLKKKFSLFILVFLLFAVICVWKKGSDYEALTLQA
KEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYH
RVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMN
KYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFP
FNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQL
GREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLV
TTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYN
FFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADL
IQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCY
YHQKFFDSACTMGAYDPLLFEKNMVKHLNEGTDEDIYLF
GKATLSGFRNIRC
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Rattus norvegicus (Rat)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
164519128
ncbi acc num :
NP_001106815.1
ncbi gb acc num :
NM_001113344.1
uniprot acc num :
P13721
ncbi mol weight :
46,732 Da
ncbi pathways :
Asparagine N-linked Glycosylation Pathway 649100!!Metabolism Of Proteins Pathway 649070!!N-Glycan Antennae Elongation Pathway 649118!!N-Glycan Biosynthesis Pathway 83367!!N-Glycan Biosynthesis Pathway 345!!N-glycan Antennae Elongation In The Medial/trans-Golgi Pathway 649115!!N-glycan Biosynthesis, Complex Type Pathway 434673!!N-glycan Biosynthesis, Complex Type Pathway 468278!!O-linked Glycosylation Of Mucins Pathway 649119!!Other Types Of O-glycan Biosynthesis Pathway 83370
ncbi summary :
may be involved in cell-type specific terminal glycosylation [RGD, Feb 2006]
uniprot summary :
Function: Transfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates. Ref.1. Catalytic activity: CMP-N-acetylneuraminate + beta-D-galactosyl-1,4-N-acetyl-beta-D-glucosamine = CMP + alpha-N-acetylneuraminyl-2,6-beta-D-galactosyl-1,4-N-acetyl-beta-D-glucosamine. Ref.1. Pathway: Protein modification; protein glycosylation. Subcellular location: Golgi apparatus Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note: Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid. Tissue specificity: Strongly expressed in liver, spleen, lung, kidney and submaxillary gland and weakly in heart and brain. Post-translational modification: The soluble form derives from the membrane form by proteolytic processing. Sequence similarities: Belongs to the glycosyltransferase 29 family.
size :
1 mg (E Coli Derived)
price :
1840 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!