product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Glandular kallikrein-7, submandibular/renal
catalog :
MBS949033
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS949033
products type :
Recombinant Protein
products full name :
Recombinant Rat Glandular kallikrein-7, submandibular/renal
products short name :
Glandular kallikrein-7
products name syn :
Esterase B; Kallikrein-related protein K1; Proteinase ARSKG-7; Tissue kallikrein
other names :
kallikrein 1; Glandular kallikrein-7, submandibular/renal; Esterase B; Kallikrein-related protein K1; Proteinase A; RSKG-7; Tissue kallikrein
products gene name :
Klk7
other gene names :
Klk7; Klk-7; rGK-7
uniprot entry name :
KLK7_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
25-261
sequence length :
261
sequence :
VIGGYKCEKNSQPWQVALYSFTKYLCGGVLIDPSWVITA
AHCSSNNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYK
PFLMRNHTRKPGDDHSNDLMLLHLSQPADITDGVKVIDL
PTEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLS
NEKCIKAYKEKVTDLMLCAGELEGGKDTCTGDSGGPLLC
DGVLQGITSWGSVPCAKTNMPAIYTKLIKFTSWIKEVMK
ENP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Predominant kallikrein protein in the kidney.
products references :
Molecular cloning and characterization of two rat renal kallikrein genes.Chen Y.-P., Chao J., Chao L.Biochemistry 27:7189-7196(1988) Characterization of serine proteinases isolated from rat submaxillary gland with special reference to the degradation of rat kininogens by these enzymes.Kato H., Nakanishi E., Enjyoji K., Hayashi I., Oh-Ishi S., Iwanaga S.J. Biochem. 102:1389-1404(1987) Substrate specificity of two kallikrein family gene products isolated from the rat submaxillary gland.Elmoujahed A., Gutman N., Brillard M., Gauthier F.FEBS Lett. 265:137-140(1990) The expression of two kallikrein gene family members in the rat kidney.Brady J.M., MacDonald R.J.Arch. Biochem. Biophys. 278:342-349(1990)
ncbi gi num :
6981132
ncbi acc num :
NP_036725.1
ncbi gb acc num :
NM_012593.1
uniprot acc num :
P36373
ncbi mol weight :
30.38kD
ncbi pathways :
Endocrine And Other Factor-regulated Calcium Reabsorption Pathway (213301); Endocrine And Other Factor-regulated Calcium Reabsorption Pathway (213276); Renin-angiotensin System Pathway (83467); Renin-angiotensin System Pathway (486)
uniprot summary :
KLK7: May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. SCCE cleaves insulin B chain at '6-Leu- -Cys-7', '16-Tyr- -Leu-17', '25-Phe- -Tyr-26' and '26-Tyr- -Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines. Belongs to the peptidase S1 family. Kallikrein subfamily. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted; EC 3.4.21.35; Secreted, signal peptide; Protease. Cellular Component: acrosome; apical part of cell; nucleus. Molecular Function: endopeptidase activity; serine-type endopeptidase activity. Biological Process: positive regulation of acute inflammatory response; positive regulation of apoptosis; positive regulation of cell proliferation; proteolysis; response to nutrient
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
990
size5 :
1 mg (E-Coli)
price5 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!