product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human IgG receptor FcRn large subunit p51
catalog :
MBS948846
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS948846
products type :
Recombinant Protein
products full name :
Recombinant Human IgG receptor FcRn large subunit p51
products short name :
IgG receptor FcRn large subunit p51
products name syn :
IgG Fc fragment receptor transporter alpha chain; Neonatal Fc receptor
other names :
IgG receptor FcRn large subunit p51; IgG receptor FcRn large subunit p51; IgG receptor FcRn large subunit p51; Fc fragment of IgG receptor and transporter; IgG Fc fragment receptor transporter alpha chain; Neonatal Fc receptor
products gene name :
FCGRT
other gene names :
FCGRT; FCGRT; FCRN; alpha-chain; FCRN; FcRn
uniprot entry name :
FCGRN_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
24-297; Provide the complete extracellular domain.
sequence length :
297
sequence :
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYN
SLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEA
FKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF
MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLL
FSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSV
LTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSF
HASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS
S
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Immunology
products description :
Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.
products references :
A major histocompatibility complex class I-like Fc receptor cloned from human placenta possible role in transfer of immunoglobulin G from mother to fetus.Story C.M., Mikulska J., Simister N.E.J. Exp. Med. 180:2377-2381(1994) Partial sequence of the human fcgrt gene and its 5' upstream region.Tiwari B., Junghans R.P.Cloning and analysis of the gene encoding the human neonatal Fc receptor.Mikulska J.E., Pablo L., Canel J., Simister N.E.Eur. J. Immunogenet. 27:231-240(2000) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
ncbi gi num :
209862839
ncbi acc num :
NP_001129491.1
ncbi gb acc num :
NM_001136019.2
uniprot acc num :
P55899
ncbi mol weight :
57.8kD
ncbi summary :
This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
uniprot summary :
FCGRT: Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus. Belongs to the immunoglobulin superfamily. Protein type: Immunoglobulin superfamily; Membrane protein, integral; Receptor, misc. Chromosomal Location of Human Ortholog: 19q13.3. Cellular Component: integral to membrane; plasma membrane. Molecular Function: antigen binding; beta-2-microglobulin binding; IgG binding; IgG receptor activity; peptide antigen binding. Biological Process: antigen processing and presentation; IgG immunoglobulin transcytosis in epithelial cells mediated by FcRn immunoglobulin receptor; immune response
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.05 mg (Yeast)
price2 :
260
size3 :
0.2 mg (E-Coli)
price3 :
490
size4 :
0.2 mg (Yeast)
price4 :
600
size5 :
0.5 mg (E-Coli)
price5 :
715
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!