product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Osteocalcin
catalog :
MBS948782
quantity :
0.01 mg (E-Coli)
price :
115 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS948782
products type :
Recombinant Protein
products full name :
Recombinant Mouse Osteocalcin
products short name :
Osteocalcin
products name syn :
Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein
other names :
osteocalcin preproprotein; Osteocalcin; osteocalcin; bone gamma carboxyglutamate protein; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein
products gene name :
Bglap
other gene names :
Bglap; Bglap; OC; BGP; OG1; mOC-A; Bglap1; BGP
uniprot entry name :
OSTCN_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
50-95
sequence length :
95
sequence :
YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYK
RIYGITI
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Mus musculus (Mouse)
products categories :
Signal Transduction
products description :
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
products references :
The mouse osteocalcin gene cluster contains three genes with two separate spatial and temporal patterns of expression." Desbois C., Hogue D.A., Karsenty G. J. Biol. Chem. 269:1183-1190(1994)
ncbi gi num :
6671634
ncbi acc num :
NP_031567.1
ncbi gb acc num :
NM_007541.3
uniprot acc num :
P86546
ncbi mol weight :
21.11kD
ncbi pathways :
Gamma Carboxylation, Hypusine Formation And Arylsulfatase Activation Pathway (1324159); Gamma-carboxylation Of Protein Precursors Pathway (1324161); Gamma-carboxylation, Transport, And Amino-terminal Cleavage Of Proteins Pathway (1324160); Metabolism Of Proteins Pathway (1324154); Post-translational Protein Modification Pathway (1324158); Removal Of Aminoterminal Propeptides From Gamma-carboxylated Proteins Pathway (1324163); Transport Of Gamma-carboxylated Protein Precursors From The Endoplasmic Reticulum To The Golgi Apparatus Pathway (1324162)
ncbi summary :
This gene encodes one of the most abundant non-collagenous proteins in bone tissue that is localized to the mineralized matrix of bone. The encoded preproprotein undergoes proteolytic processing and post-translational gamma carboxylation to generate a mature, calcium-binding protein. Mice lacking the encoded protein develop abnormalities of bone remodelling. This gene is located adjacent to two other osteocalcin-related genes on chromosome 3. [provided by RefSeq, Oct 2015]
size1 :
0.01 mg (E-Coli)
price1 :
115 USD
size2 :
0.05 mg (E-Coli)
price2 :
185
size3 :
0.2 mg (E-Coli)
price3 :
420
size4 :
0.5 mg (E-Coli)
price4 :
680
size5 :
1 mg (E-Coli)
price5 :
1070
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!