catalog number :
MBS948697
products type :
Recombinant Protein
products full name :
Recombinant Human C-X-C chemokine receptor type 1 (CXCR1)
products short name :
C-X-C chemokine receptor type 1 (CXCR1)
products name syn :
Recombinant C-X-C chemokine receptor type 1 (CXCR1); C-X-C chemokine receptor type 1; CXC-R1; CXCR-1; CDw128a High affinity interleukin-8 receptor A; IL-8R A IL-8 receptor type 1 CD_antigen= CD181
other names :
C-X-C chemokine receptor type 1; C-X-C chemokine receptor type 1; C-X-C chemokine receptor type 1; CXC-R1; CXCR-1; IL-8R A; IL-8 receptor type 1; interleukin 8 receptor, alpha; interleukin-8 receptor type 1; interleukin-8 receptor type A; high affinity interleukin-8 receptor A; chemokine (C-X-C motif) receptor 1; CDw128a; High affinity interleukin-8 receptor A; IL-8R A; IL-8 receptor type 1
products gene name syn :
CXCR1; CMKAR1, IL8RA
other gene names :
CXCR1; CXCR1; C-C; CD128; CD181; CKR-1; IL8R1; IL8RA; CMKAR1; IL8RBA; CDw128a; C-C-CKR-1; CMKAR1; IL8RA; CXC-R1; CXCR-1; IL-8R A
uniprot entry name :
CXCR1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
Jan-39
sequence :
MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes ? Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
other info1 :
Species: Homo sapiens (Human)
products description :
Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to MGSA (GRO) with a low affinity.
ncbi acc num :
NP_000625.1
ncbi gb acc num :
NM_000634.2
ncbi pathways :
Chemokine Receptors Bind Chemokines Pathway (106359); Chemokine Signaling Pathway (99051); Chemokine Signaling Pathway (96864); Class A/1 (Rhodopsin-like Receptors) Pathway (106357); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Endocytosis Pathway (102279); Endocytosis Pathway (102181); Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway (83102); Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway (515)
ncbi summary :
The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. Knockout studies in mice suggested that this protein inhibits embryonic oligodendrocyte precursor migration in developing spinal cord. This gene, IL8RB, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. [provided by RefSeq, Jul 2008]
uniprot summary :
IL8RA: Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to MGSA (GRO) with a low affinity. Belongs to the G-protein coupled receptor 1 family. Protein type: Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; Receptor, cytokine; GPCR, family 1. Chromosomal Location of Human Ortholog: 2q35. Cellular Component: membrane; integral to membrane; plasma membrane. Molecular Function: G-protein coupled receptor activity; interleukin-8 receptor activity; chemokine receptor activity; interleukin-8 binding. Biological Process: G-protein coupled receptor protein signaling pathway; cell surface receptor linked signal transduction; receptor internalization; dendritic cell chemotaxis; chemotaxis; inflammatory response. Disease: Human Immunodeficiency Virus Type 1, Susceptibility To