Recombinant Human Homeobox protein Hox-B4 | MyBioSource MBS948606 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Homeobox protein Hox-B4

catalog :

MBS948606

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS948606

products type :

Recombinant Protein

products full name :

Recombinant Human Homeobox protein Hox-B4

products short name :

Homeobox protein Hox-B4

products name syn :

Homeobox protein Hox-2.6; Homeobox protein Hox-2F

other names :

homeobox protein Hox-B4; Homeobox protein Hox-B4; homeobox protein Hox-B4; homeobox B4; Homeobox protein Hox-2.6; Homeobox protein Hox-2F

products gene name :

HOXB4

other gene names :

HOXB4; HOXB4; HOX2; HOX2F; HOX-2.6; HOX2F

uniprot entry name :

HXB4_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-251

sequence length :

251

sequence :

MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYA
GGQRRESSFQPEAGFGRRAACTVQRYAACRDPGPPPPPP
PPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSP
PPPPCAQNPLHPSPSHSACKEPVVYPWMRKVHVSTVNPN
YAGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEI
AHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAA
GSAGGPPGRPNGGPRAL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Transcription

products description :

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

products references :

Expression of HOX homeogenes in human neuroblastoma cell culture lines.Peverali F.A., D'Esposito M., Acampora D., Bunone G., Negri M., Faiella A., Stornaiuolo A., Pannese M., Migliaccio E., Simeone A., Valle G.D., Boncinelli E.Differentiation 45:61-69(1990) Overall linkage disequilibrium in 33 populations for highly informative multisite haplotypes spanning the HOXB gene cluster.Kidd K.K., Busygina V., De;Mille M.M.C., Speed W.C., Ruggeri V., Kidd J.R., Pakstis A.J.Am. J. Hum. Genet. 67:235-235(2000) Hematopoietic expression of HOXB4 is regulated in normal and leukemic stem cells through transcriptional activation of the HOXB4 promoter by upstream stimulating factor (USF) -1 and USF-2.Giannola D.M., Shlomchik W.D., Jegathesan M., Liebowitz D., Abrams C.S., Kadesch T., Dancis A., Emerson S.G.J. Exp. Med. 192:1479-1490(2000) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system.Giampaolo A., Acampora D., Zappavigna V., Pannese M., D'Esposito M., Care A., Faiella A., Stornaiuolo A., Russo G., Simeone A., Boncinelli E., Peschle C.Differentiation 40:191-197(1989) Organization of human class I homeobox genes.Boncinelli E., Acampora D., Pannese M., D'Esposito M., Somma R., Gaudino G., Stornaiuolo A., Cafiero M., Faiella A., Simeone A.Genome 31:745-756(1989)

ncbi gi num :

13273315

ncbi acc num :

NP_076920.1

ncbi gb acc num :

NM_024015.4

uniprot acc num :

P17483

ncbi mol weight :

29.6kD

ncbi pathways :

Activation Of HOX Genes During Differentiation Pathway (1339139); Activation Of Anterior HOX Genes In Hindbrain Development During Early Embryogenesis Pathway (1339140); Developmental Biology Pathway (1270302)

ncbi summary :

This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion. [provided by RefSeq, Jul 2008]

uniprot summary :

HOXB4: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Antp homeobox family. Deformed subfamily. Protein type: DNA-binding; Transcription factor. Chromosomal Location of Human Ortholog: 17q21.32. Cellular Component: nucleus. Molecular Function: sequence-specific DNA binding; transcription factor activity. Biological Process: anterior/posterior pattern formation; bone marrow development; cell proliferation; embryonic skeletal morphogenesis; morphogenesis of an epithelial sheet; negative regulation of transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter; somatic stem cell division; spleen development; transcription, DNA-dependent

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

1000

size5 :

1 mg (E-Coli)

price5 :

1180

more info or order :

MyBioSource product webpage